JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB117219

Recombinant Human p38 beta/MAPK11 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human p38 beta/MAPK11 protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 364 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

PRKM11, SAPK2, SAPK2B, MAPK11, Mitogen-activated protein kinase 11, MAP kinase 11, MAPK 11, Mitogen-activated protein kinase p38 beta, Stress-activated protein kinase 2b, p38-2, MAP kinase p38 beta, p38b, SAPK2b

5 Images
Western blot - Recombinant Human p38 beta/MAPK11 protein (His tag N-Terminus) (AB117219)
  • WB

Unknown

Western blot - Recombinant Human p38 beta/MAPK11 protein (His tag N-Terminus) (AB117219)

All lanes:

Western blot - Anti-p38 beta/MAPK11 antibody [E13-Q] - C-terminal (<a href='/en-us/products/primary-antibodies/p38-beta-mapk11-antibody-e13-q-c-terminal-ab183208'>ab183208</a>) at 1/1000 dilution

Lane 1:

Western blot - Recombinant Human p38 beta/MAPK11 protein (His tag N-Terminus) (ab117219)

Lane 2:

Western blot - Recombinant Human p38 gamma/MAPK12 protein (His tag N-Terminus) (<a href='/en-us/products/proteins-peptides/recombinant-human-p38-gamma-mapk12-protein-ab117221'>ab117221</a>)

Lane 3:

Western blot - Recombinant Human p38 delta/MAPK13 protein (His tag N-Terminus) (<a href='/en-us/products/proteins-peptides/recombinant-human-p38-delta-mapk13-protein-ab113869'>ab113869</a>)

Lane 4:

Western blot - Recombinant Human p38 alpha/MAPK14 protein (<a href='/en-us/products/proteins-peptides/recombinant-human-p38-alpha-mapk14-protein-ab82188'>ab82188</a>)

Predicted band size: 41 kDa

false

Western blot - Recombinant Human p38 beta/MAPK11 protein (His tag N-Terminus) (AB117219)
  • WB

Unknown

Western blot - Recombinant Human p38 beta/MAPK11 protein (His tag N-Terminus) (AB117219)

All lanes:

Western blot - Anti-p38 delta/MAPK13 + p38 alpha/MAPK14 antibody [M138] (<a href='/en-us/products/primary-antibodies/p38-delta-mapk13-p38-alpha-mapk14-antibody-m138-ab31828'>ab31828</a>) at 1/1000 dilution

Lane 1:

Western blot - Recombinant Human p38 beta/MAPK11 protein (His tag N-Terminus) (ab117219)

Lane 2:

Western blot - Recombinant Human p38 gamma/MAPK12 protein (His tag N-Terminus) (<a href='/en-us/products/proteins-peptides/recombinant-human-p38-gamma-mapk12-protein-ab117221'>ab117221</a>)

Lane 3:

Western blot - Recombinant Human p38 delta/MAPK13 protein (His tag N-Terminus) (<a href='/en-us/products/proteins-peptides/recombinant-human-p38-delta-mapk13-protein-ab113869'>ab113869</a>)

Lane 4:

Western blot - Recombinant Human p38 alpha/MAPK14 protein (<a href='/en-us/products/proteins-peptides/recombinant-human-p38-alpha-mapk14-protein-ab82188'>ab82188</a>)

false

Western blot - Recombinant Human p38 beta/MAPK11 protein (His tag N-Terminus) (AB117219)
  • WB

Unknown

Western blot - Recombinant Human p38 beta/MAPK11 protein (His tag N-Terminus) (AB117219)

All lanes:

Western blot - Anti-p38 alpha/MAPK14 antibody [9F12] (<a href='/en-us/products/primary-antibodies/p38-alpha-mapk14-antibody-9f12-ab59461'>ab59461</a>) at 1/1000 dilution

Lane 1:

Western blot - Recombinant Human p38 beta/MAPK11 protein (His tag N-Terminus) (ab117219)

Lane 2:

Western blot - Recombinant Human p38 gamma/MAPK12 protein (His tag N-Terminus) (<a href='/en-us/products/proteins-peptides/recombinant-human-p38-gamma-mapk12-protein-ab117221'>ab117221</a>)

Lane 3:

Western blot - Recombinant Human p38 delta/MAPK13 protein (His tag N-Terminus) (<a href='/en-us/products/proteins-peptides/recombinant-human-p38-delta-mapk13-protein-ab113869'>ab113869</a>)

Lane 4:

Western blot - Recombinant Human p38 alpha/MAPK14 protein (<a href='/en-us/products/proteins-peptides/recombinant-human-p38-alpha-mapk14-protein-ab82188'>ab82188</a>)

Predicted band size: 41 kDa

false

Western blot - Recombinant Human p38 beta/MAPK11 protein (His tag N-Terminus) (AB117219)
  • WB

Unknown

Western blot - Recombinant Human p38 beta/MAPK11 protein (His tag N-Terminus) (AB117219)

This data was developed using the same antibody clone in a different buffer formulation (ab32142).

All lanes:

Western blot - Anti-p38 beta/MAPK11 + p38 alpha/MAPK14 antibody [Y122] (<a href='/en-us/products/primary-antibodies/p38-beta-mapk11-p38-alpha-mapk14-antibody-y122-ab32142'>ab32142</a>) at 1/1000 dilution

Lane 1:

Western blot - Recombinant Human p38 beta/MAPK11 protein (His tag N-Terminus) (ab117219)

Lane 2:

Western blot - Recombinant Human p38 gamma/MAPK12 protein (His tag N-Terminus) (<a href='/en-us/products/proteins-peptides/recombinant-human-p38-gamma-mapk12-protein-ab117221'>ab117221</a>)

Lane 3:

Western blot - Recombinant Human p38 delta/MAPK13 protein (His tag N-Terminus) (<a href='/en-us/products/proteins-peptides/recombinant-human-p38-delta-mapk13-protein-ab113869'>ab113869</a>)

Lane 4:

Western blot - Recombinant Human p38 alpha/MAPK14 protein (<a href='/en-us/products/proteins-peptides/recombinant-human-p38-alpha-mapk14-protein-ab82188'>ab82188</a>)

false

SDS-PAGE - Recombinant Human p38 beta/MAPK11 protein (His tag N-Terminus) (AB117219)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human p38 beta/MAPK11 protein (His tag N-Terminus) (AB117219)

SDS-PAGE of ab117219 (3µg) under reducing condition and visualized by coomassie blue stain.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q15759

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.32% Tris HCl, 0.03% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ","proteinLength":"Full Length","predictedMolecularWeight":"43.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":364,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q15759","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The target p38 beta also known as MAPK11 is a member of the mitogen-activated protein kinase (MAPK) family specifically the p38 MAPK subfamily. It weighs approximately 41 kDa and can be expressed in various tissues but shows higher levels in skeletal muscle and heart tissue. This protein operates as a serine/threonine kinase playing an important role in delivering signals from the cell surface to the DNA in the cell nucleus. p38 beta influences transcription factors leading to the regulation of gene expression in response to external stimuli.
Biological function summary

The p38 beta/MAPK11 protein serves an essential role in cellular processes such as inflammation cell differentiation and apoptosis. It can form part of a larger signaling complex that is activated by various stress signals including cytokines and environmental stress suggesting its involvement in stress response pathways. The activation of this kinase results in the phosphorylation of downstream targets leading to various biological responses.

Pathways

P38 beta/MAPK11 is important in the MAPK signaling pathway and is closely linked to the stress-activated protein kinase/c-Jun N-terminal kinase (SAPK/JNK) pathway. In these pathways it interacts with other proteins such as MKK3 and MKK6 which are upstream activators. This pathway mediates responses to stress and inflammatory cytokines and regulates the production of inflammatory proteins and apoptosis-related factors.

P38 beta/MAPK11 plays an important role in conditions like cancer and chronic inflammatory diseases. Its modulation can affect cancer cell proliferation where it interacts with other MAPK family members. Alterations in the p38 MAPK signaling have been associated with rheumatoid arthritis where p38 beta works alongside p38 alpha to mediate pro-inflammatory cytokine production. Understanding these connections helps develop targeted therapies for these diseases.

Specifications

Form

Liquid

Additional notes

ab117219 is purified using conventional chromatography techniques.

General info

Function

Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway (PubMed : 12452429, PubMed : 20626350, PubMed : 35857590). MAPK11 is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli such as pro-inflammatory cytokines or physical stress leading to direct activation of transcription factors (PubMed : 12452429, PubMed : 20626350, PubMed : 35857590). Accordingly, p38 MAPKs phosphorylate a broad range of proteins and it has been estimated that they may have approximately 200 to 300 substrates each (PubMed : 12452429, PubMed : 20626350, PubMed : 35857590). MAPK11 functions are mostly redundant with those of MAPK14 (PubMed : 12452429, PubMed : 20626350, PubMed : 35857590). Some of the targets are downstream kinases which are activated through phosphorylation and further phosphorylate additional targets (PubMed : 12452429, PubMed : 20626350). RPS6KA5/MSK1 and RPS6KA4/MSK2 can directly phosphorylate and activate transcription factors such as CREB1, ATF1, the NF-kappa-B isoform RELA/NFKB3, STAT1 and STAT3, but can also phosphorylate histone H3 and the nucleosomal protein HMGN1 (PubMed : 9687510). RPS6KA5/MSK1 and RPS6KA4/MSK2 play important roles in the rapid induction of immediate-early genes in response to stress or mitogenic stimuli, either by inducing chromatin remodeling or by recruiting the transcription machinery. On the other hand, two other kinase targets, MAPKAPK2/MK2 and MAPKAPK3/MK3, participate in the control of gene expression mostly at the post-transcriptional level, by phosphorylating ZFP36 (tristetraprolin) and ELAVL1, and by regulating EEF2K, which is important for the elongation of mRNA during translation. MKNK1/MNK1 and MKNK2/MNK2, two other kinases activated by p38 MAPKs, regulate protein synthesis by phosphorylating the initiation factor EIF4E2 (PubMed : 11154262). In the cytoplasm, the p38 MAPK pathway is an important regulator of protein turnover. For example, CFLAR is an inhibitor of TNF-induced apoptosis whose proteasome-mediated degradation is regulated by p38 MAPK phosphorylation. Ectodomain shedding of transmembrane proteins is regulated by p38 MAPKs as well. In response to inflammatory stimuli, p38 MAPKs phosphorylate the membrane-associated metalloprotease ADAM17. Such phosphorylation is required for ADAM17-mediated ectodomain shedding of TGF-alpha family ligands, which results in the activation of EGFR signaling and cell proliferation. Additional examples of p38 MAPK substrates are the FGFR1. FGFR1 can be translocated from the extracellular space into the cytosol and nucleus of target cells, and regulates processes such as rRNA synthesis and cell growth. FGFR1 translocation requires p38 MAPK activation. In the nucleus, many transcription factors are phosphorylated and activated by p38 MAPKs in response to different stimuli. Classical examples include ATF1, ATF2, ATF6, ELK1, PTPRH, DDIT3, TP53/p53 and MEF2C and MEF2A (PubMed : 10330143, PubMed : 15356147, PubMed : 9430721). The p38 MAPKs are emerging as important modulators of gene expression by regulating chromatin modifiers and remodelers (PubMed : 10330143, PubMed : 15356147, PubMed : 9430721). The promoters of several genes involved in the inflammatory response, such as IL6, IL8 and IL12B, display a p38 MAPK-dependent enrichment of histone H3 phosphorylation on 'Ser-10' (H3S10ph) in LPS-stimulated myeloid cells. This phosphorylation enhances the accessibility of the cryptic NF-kappa-B-binding sites marking promoters for increased NF-kappa-B recruitment. Phosphorylates NLRP1 downstream of MAP3K20/ZAK in response to UV-B irradiation and ribosome collisions, promoting activation of the NLRP1 inflammasome and pyroptosis (PubMed : 35857590). Phosphorylates methyltransferase DOT1L on 'Ser-834', 'Thr-900', 'Ser-902', 'Thr-984', 'Ser-1001', 'Ser-1009' and 'Ser-1104' (PubMed : 38270553).

Sequence similarities

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.

Post-translational modifications

Dually phosphorylated on Thr-180 and Tyr-182 by MAP2K3/MKK3, MAP2K4/MKK4 and MAP2K6/MKK6, which activates the enzyme.

Subcellular localisation

Nucleus

Product protocols

Target data

Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway (PubMed : 12452429, PubMed : 20626350, PubMed : 35857590). MAPK11 is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli such as pro-inflammatory cytokines or physical stress leading to direct activation of transcription factors (PubMed : 12452429, PubMed : 20626350, PubMed : 35857590). Accordingly, p38 MAPKs phosphorylate a broad range of proteins and it has been estimated that they may have approximately 200 to 300 substrates each (PubMed : 12452429, PubMed : 20626350, PubMed : 35857590). MAPK11 functions are mostly redundant with those of MAPK14 (PubMed : 12452429, PubMed : 20626350, PubMed : 35857590). Some of the targets are downstream kinases which are activated through phosphorylation and further phosphorylate additional targets (PubMed : 12452429, PubMed : 20626350). RPS6KA5/MSK1 and RPS6KA4/MSK2 can directly phosphorylate and activate transcription factors such as CREB1, ATF1, the NF-kappa-B isoform RELA/NFKB3, STAT1 and STAT3, but can also phosphorylate histone H3 and the nucleosomal protein HMGN1 (PubMed : 9687510). RPS6KA5/MSK1 and RPS6KA4/MSK2 play important roles in the rapid induction of immediate-early genes in response to stress or mitogenic stimuli, either by inducing chromatin remodeling or by recruiting the transcription machinery. On the other hand, two other kinase targets, MAPKAPK2/MK2 and MAPKAPK3/MK3, participate in the control of gene expression mostly at the post-transcriptional level, by phosphorylating ZFP36 (tristetraprolin) and ELAVL1, and by regulating EEF2K, which is important for the elongation of mRNA during translation. MKNK1/MNK1 and MKNK2/MNK2, two other kinases activated by p38 MAPKs, regulate protein synthesis by phosphorylating the initiation factor EIF4E2 (PubMed : 11154262). In the cytoplasm, the p38 MAPK pathway is an important regulator of protein turnover. For example, CFLAR is an inhibitor of TNF-induced apoptosis whose proteasome-mediated degradation is regulated by p38 MAPK phosphorylation. Ectodomain shedding of transmembrane proteins is regulated by p38 MAPKs as well. In response to inflammatory stimuli, p38 MAPKs phosphorylate the membrane-associated metalloprotease ADAM17. Such phosphorylation is required for ADAM17-mediated ectodomain shedding of TGF-alpha family ligands, which results in the activation of EGFR signaling and cell proliferation. Additional examples of p38 MAPK substrates are the FGFR1. FGFR1 can be translocated from the extracellular space into the cytosol and nucleus of target cells, and regulates processes such as rRNA synthesis and cell growth. FGFR1 translocation requires p38 MAPK activation. In the nucleus, many transcription factors are phosphorylated and activated by p38 MAPKs in response to different stimuli. Classical examples include ATF1, ATF2, ATF6, ELK1, PTPRH, DDIT3, TP53/p53 and MEF2C and MEF2A (PubMed : 10330143, PubMed : 15356147, PubMed : 9430721). The p38 MAPKs are emerging as important modulators of gene expression by regulating chromatin modifiers and remodelers (PubMed : 10330143, PubMed : 15356147, PubMed : 9430721). The promoters of several genes involved in the inflammatory response, such as IL6, IL8 and IL12B, display a p38 MAPK-dependent enrichment of histone H3 phosphorylation on 'Ser-10' (H3S10ph) in LPS-stimulated myeloid cells. This phosphorylation enhances the accessibility of the cryptic NF-kappa-B-binding sites marking promoters for increased NF-kappa-B recruitment. Phosphorylates NLRP1 downstream of MAP3K20/ZAK in response to UV-B irradiation and ribosome collisions, promoting activation of the NLRP1 inflammasome and pyroptosis (PubMed : 35857590). Phosphorylates methyltransferase DOT1L on 'Ser-834', 'Thr-900', 'Ser-902', 'Thr-984', 'Ser-1001', 'Ser-1009' and 'Ser-1104' (PubMed : 38270553).
See full target information MAPK11

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com