JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB113869

Recombinant Human p38 delta/MAPK13 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human p38 delta/MAPK13 protein is a Human Full Length protein, in the 1 to 365 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

PRKM13, SAPK4, MAPK13, Mitogen-activated protein kinase 13, MAP kinase 13, MAPK 13, Mitogen-activated protein kinase p38 delta, Stress-activated protein kinase 4, MAP kinase p38 delta

6 Images
Western blot - Recombinant Human p38 delta/MAPK13 protein (AB113869)
  • WB

Unknown

Western blot - Recombinant Human p38 delta/MAPK13 protein (AB113869)

All lanes:

Western blot - Anti-p38 beta/MAPK11 antibody [E13-Q] - C-terminal (<a href='/en-us/products/primary-antibodies/p38-beta-mapk11-antibody-e13-q-c-terminal-ab183208'>ab183208</a>) at 1/1000 dilution

Lane 1:

Western blot - Recombinant Human p38 beta/MAPK11 protein (<a href='/en-us/products/proteins-peptides/recombinant-human-p38-beta-mapk11-protein-ab117219'>ab117219</a>)

Lane 2:

Western blot - Recombinant Human p38 gamma/MAPK12 protein (<a href='/en-us/products/proteins-peptides/recombinant-human-p38-gamma-mapk12-protein-ab117221'>ab117221</a>)

Lane 3:

Western blot - Recombinant Human p38 delta/MAPK13 protein (ab113869)

Lane 4:

Western blot - Recombinant Human p38 alpha/MAPK14 protein (<a href='/en-us/products/proteins-peptides/recombinant-human-p38-alpha-mapk14-protein-ab82188'>ab82188</a>)

Predicted band size: 41 kDa

false

Western blot - Recombinant Human p38 delta/MAPK13 protein (AB113869)
  • WB

Unknown

Western blot - Recombinant Human p38 delta/MAPK13 protein (AB113869)

All lanes:

Western blot - Anti-p38 alpha/MAPK14 antibody [9F12] (<a href='/en-us/products/primary-antibodies/p38-alpha-mapk14-antibody-9f12-ab59461'>ab59461</a>) at 1/1000 dilution

Lane 1:

Western blot - Recombinant Human p38 beta/MAPK11 protein (<a href='/en-us/products/proteins-peptides/recombinant-human-p38-beta-mapk11-protein-ab117219'>ab117219</a>)

Lane 2:

Western blot - Recombinant Human p38 gamma/MAPK12 protein (<a href='/en-us/products/proteins-peptides/recombinant-human-p38-gamma-mapk12-protein-ab117221'>ab117221</a>)

Lane 3:

Western blot - Recombinant Human p38 delta/MAPK13 protein (ab113869)

Lane 4:

Western blot - Recombinant Human p38 alpha/MAPK14 protein (<a href='/en-us/products/proteins-peptides/recombinant-human-p38-alpha-mapk14-protein-ab82188'>ab82188</a>)

Predicted band size: 41 kDa

false

Western blot - Recombinant Human p38 delta/MAPK13 protein (AB113869)
  • WB

Unknown

Western blot - Recombinant Human p38 delta/MAPK13 protein (AB113869)

This data was developed using the same antibody clone in a different buffer formulation (ab32142).

All lanes:

Western blot - Anti-p38 beta/MAPK11 + p38 alpha/MAPK14 antibody [Y122] (<a href='/en-us/products/primary-antibodies/p38-beta-mapk11-p38-alpha-mapk14-antibody-y122-ab32142'>ab32142</a>) at 1/1000 dilution

Lane 1:

Western blot - Recombinant Human p38 beta/MAPK11 protein (<a href='/en-us/products/proteins-peptides/recombinant-human-p38-beta-mapk11-protein-ab117219'>ab117219</a>)

Lane 2:

Western blot - Recombinant Human p38 gamma/MAPK12 protein (<a href='/en-us/products/proteins-peptides/recombinant-human-p38-gamma-mapk12-protein-ab117221'>ab117221</a>)

Lane 3:

Western blot - Recombinant Human p38 delta/MAPK13 protein (ab113869)

Lane 4:

Western blot - Recombinant Human p38 alpha/MAPK14 protein (<a href='/en-us/products/proteins-peptides/recombinant-human-p38-alpha-mapk14-protein-ab82188'>ab82188</a>)

false

Western blot - Recombinant Human p38 delta/MAPK13 protein (AB113869)
  • WB

Unknown

Western blot - Recombinant Human p38 delta/MAPK13 protein (AB113869)

All lanes:

Western blot - Anti-p38 delta/MAPK13 + p38 alpha/MAPK14 antibody [M138] (<a href='/en-us/products/primary-antibodies/p38-delta-mapk13-p38-alpha-mapk14-antibody-m138-ab31828'>ab31828</a>) at 1/1000 dilution

Lane 1:

Western blot - Recombinant Human p38 beta/MAPK11 protein (<a href='/en-us/products/proteins-peptides/recombinant-human-p38-beta-mapk11-protein-ab117219'>ab117219</a>)

Lane 2:

Western blot - Recombinant Human p38 gamma/MAPK12 protein (<a href='/en-us/products/proteins-peptides/recombinant-human-p38-gamma-mapk12-protein-ab117221'>ab117221</a>)

Lane 3:

Western blot - Recombinant Human p38 delta/MAPK13 protein (ab113869)

Lane 4:

Western blot - Recombinant Human p38 alpha/MAPK14 protein (<a href='/en-us/products/proteins-peptides/recombinant-human-p38-alpha-mapk14-protein-ab82188'>ab82188</a>)

false

SDS-PAGE - Recombinant Human p38 delta/MAPK13 protein (AB113869)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human p38 delta/MAPK13 protein (AB113869)

15% SDS-PAGE analysis of 3 μg ab113869.

SDS-PAGE - Recombinant Human p38 delta/MAPK13 protein (AB113869)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human p38 delta/MAPK13 protein (AB113869)

SDS-PAGE analysis of ab113869

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

O15264

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL","proteinLength":"Full Length","predictedMolecularWeight":"44.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":365,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O15264","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

P38 delta also known as MAPK13 is a member of the mitogen-activated protein kinase (MAPK) family. It has a molecular weight of about 43 kDa. This kinase is involved in transmitting signals from the cell surface to the DNA in the cell nucleus affecting gene expression. You can find MAPK13 expression in various tissues such as skin lung and pancreas. It plays a role in cellular responses to stress and inflammation helping to regulate diverse cellular processes like gene expression differentiation and apoptosis.
Biological function summary

The function of MAPK13 extends to its involvement in multiple cellular processes linked to stress responses. It forms part of a signaling complex that responds to extracellular stimuli. MAPK13 contributes to regulating inflammation by mediating the transcriptional activity of specific genes. Through phosphorylation it modifies other proteins and influences pathways that control cell growth and apoptosis. Cellular stress and environmental changes activate this kinase highlighting its role in helping cells adapt.

Pathways

MAPK13 integrates into the MAPK signaling pathway contributing to the transmission and amplification of signals related to cellular stress and inflammatory responses. It interacts with other proteins like MAPK14 (p38 alpha) within these pathways emphasizing its role in mediating cellular reactions to stress. The MAPK pathway influences the activity of transcription factors impacting gene expression and cellular outcomes. MAPK13 also plays a role in the p38 MAPK pathway emphasizing its connection within these essential signaling networks.

MAPK13 relates to conditions such as inflammatory diseases and cancer. Its role in inflammation links MAPK13 to diseases like chronic obstructive pulmonary disease (COPD) where excessive inflammatory responses contribute to disease progression. It also connects to cancer progression where abnormal cell signaling leads to uncontrolled growth. In these conditions MAPK13 interacts with other proteins such as NF-kB which further influence disease outcomes by modulating inflammatory and cell survival pathways.

Specifications

Form

Liquid

Additional notes

ab113869 was purified using conventional chromatography.

General info

Function

Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK13 is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli such as pro-inflammatory cytokines or physical stress leading to direct activation of transcription factors such as ELK1 and ATF2. Accordingly, p38 MAPKs phosphorylate a broad range of proteins and it has been estimated that they may have approximately 200 to 300 substrates each. MAPK13 is one of the less studied p38 MAPK isoforms. Some of the targets are downstream kinases such as MAPKAPK2, which are activated through phosphorylation and further phosphorylate additional targets. Plays a role in the regulation of protein translation by phosphorylating and inactivating EEF2K. Involved in cytoskeletal remodeling through phosphorylation of MAPT and STMN1. Mediates UV irradiation induced up-regulation of the gene expression of CXCL14. Plays an important role in the regulation of epidermal keratinocyte differentiation, apoptosis and skin tumor development. Phosphorylates the transcriptional activator MYB in response to stress which leads to rapid MYB degradation via a proteasome-dependent pathway. MAPK13 also phosphorylates and down-regulates PRKD1 during regulation of insulin secretion in pancreatic beta cells.

Sequence similarities

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.

Post-translational modifications

Dually phosphorylated on Thr-180 and Tyr-182 by MAP2K3/MKK3, MAP2K4/MKK4, MAP2K6/MKK6 and MAP2K7/MKK7, which activates the enzyme. Dephosphorylated by dual specificity phosphatase DUSP1.

Product protocols

Target data

Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK13 is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli such as pro-inflammatory cytokines or physical stress leading to direct activation of transcription factors such as ELK1 and ATF2. Accordingly, p38 MAPKs phosphorylate a broad range of proteins and it has been estimated that they may have approximately 200 to 300 substrates each. MAPK13 is one of the less studied p38 MAPK isoforms. Some of the targets are downstream kinases such as MAPKAPK2, which are activated through phosphorylation and further phosphorylate additional targets. Plays a role in the regulation of protein translation by phosphorylating and inactivating EEF2K. Involved in cytoskeletal remodeling through phosphorylation of MAPT and STMN1. Mediates UV irradiation induced up-regulation of the gene expression of CXCL14. Plays an important role in the regulation of epidermal keratinocyte differentiation, apoptosis and skin tumor development. Phosphorylates the transcriptional activator MYB in response to stress which leads to rapid MYB degradation via a proteasome-dependent pathway. MAPK13 also phosphorylates and down-regulates PRKD1 during regulation of insulin secretion in pancreatic beta cells.
See full target information MAPK13

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com