JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB180267

Recombinant Human PACAP protein - BSA and Azide free

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human PACAP protein - BSA and Azide free is a Human Full Length protein, in the 1 to 97 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

MEDA7, PACAP, HSPC190, MZB1, Marginal zone B- and B1-cell-specific protein, Mesenteric estrogen-dependent adipose 7, Plasma cell-induced resident endoplasmic reticulum protein, Proapoptotic caspase adapter protein, MEDA-7, Plasma cell-induced resident ER protein, pERp1

1 Images
SDS-PAGE - Recombinant Human PACAP protein - BSA and Azide free (AB180267)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human PACAP protein - BSA and Azide free (AB180267)

15% SDS-PAGE analysis of ab180267 (3 μg)

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Q8WU39

Animal free

No

Carrier free

Yes

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as Proapoptotic Caspase Adaptor Protein

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMPAELWLTSYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATREEL","proteinLength":"Full Length","predictedMolecularWeight":"12.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":97,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q8WU39","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

PACAP also known as Pituitary Adenylate Cyclase-Activating Polypeptide is a neuropeptide functioning as a neurotransmitter and neuromodulator. It belongs to the vasoactive intestinal peptide (VIP)/secretin/glucagon hormone family. PACAP consists of 38 amino acid residues and has a molecular mass of approximately 4.5 kDa. It is expressed in various regions including the central nervous system (CNS) endocrine cells and peripheral tissues. This broad expression pattern supports its diverse role in physiological and neurobiological processes.
Biological function summary

PACAP exerts multiple effects by binding to three G protein-coupled receptors: PAC1 VPAC1 and VPAC2. It influences processes like neuroprotection neurodevelopment and neurotransmission. As part of the PACAP/VIP receptor complex it regulates cyclic AMP production and calcium signaling mediating its effects in both neural and non-neural tissues. It is particularly involved in paired functions with neurotransmitters and other signaling molecules indicating its key role in maintaining homeostasis.

Pathways

The PACAP signaling mechanism integrates into the cAMP-dependent pathway and the MAPK/ERK pathway. These pathways are central to cell proliferation differentiation and survival. PACAP's interaction with MAPK/ERK pathway involves proteins such as Raf and MEK further modulating gene expression and synaptic plasticity. By this mechanism PACAP plays a vital role in modulating neurotransmission and neuroendocrine functions.

PACAP is linked to migraine and neurodegenerative diseases like Alzheimer's disease. Alterations in PACAP signaling can affect pain pathways and neuroinflammation potentially exacerbating such conditions. PACAP's interaction with proteins like CGRP (Calcitonin Gene-Related Peptide) is significant as both are implicated in the pathophysiology of migraines. Moreover in Alzheimer’s disease the dysregulation of PACAP and its receptors contributes to neuroinflammation and neurodegeneration.

Specifications

Form

Liquid

Additional notes

ab180267 was purified using conventional chromatography.

General info

Function

Associates with immunoglobulin M (IgM) heavy and light chains and promotes IgM assembly and secretion. May exert its effect by acting as a molecular chaperone or as an oxidoreductase as it displays a low level of oxidoreductase activity (By similarity). Isoform 2 may be involved in regulation of apoptosis. Helps to diversify peripheral B-cell functions by regulating Ca(2+) stores, antibody secretion and integrin activation.. Acts as a hormone-regulated adipokine/pro-inflammatory cytokine that is implicated in causing chronic inflammation, affecting cellular expansion and blunting insulin response in adipocytes. May have a role in the onset of insulin resistance.

Sequence similarities

Belongs to the MZB1 family.

Post-translational modifications

Forms an interchain disulfide bond with IgM monomers.

Product protocols

Target data

Associates with immunoglobulin M (IgM) heavy and light chains and promotes IgM assembly and secretion. May exert its effect by acting as a molecular chaperone or as an oxidoreductase as it displays a low level of oxidoreductase activity (By similarity). Isoform 2 may be involved in regulation of apoptosis. Helps to diversify peripheral B-cell functions by regulating Ca(2+) stores, antibody secretion and integrin activation.. Acts as a hormone-regulated adipokine/pro-inflammatory cytokine that is implicated in causing chronic inflammation, affecting cellular expansion and blunting insulin response in adipocytes. May have a role in the onset of insulin resistance.
See full target information MZB1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com