JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB177625

Recombinant Human Parkin protein (denatured)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human Parkin protein (denatured) is a Human Full Length protein, in the 1 to 465 aa range, expressed in Escherichia coli, with >80%, suitable for SDS-PAGE.

View Alternative Names

PARK2, PRKN, E3 ubiquitin-protein ligase parkin, Parkin, Parkin RBR E3 ubiquitin-protein ligase, Parkinson juvenile disease protein 2, Parkinson disease protein 2

1 Images
SDS-PAGE - Recombinant Human Parkin protein (denatured) (AB177625)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Parkin protein (denatured) (AB177625)

15% SDS-PAGE analysis of ab177625 (3 μg).

Key facts

Purity

>80% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

O60260

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 2.4% Urea, 0.32% Tris-HCl buffer

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV","proteinLength":"Full Length","predictedMolecularWeight":"53.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":465,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O60260","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The Parkin protein also known as PRK8 or Park2 is an E3 ubiquitin ligase with a molecular weight of approximately 52 kDa. This protein plays a critical role in tagging damaged proteins for degradation maintaining cellular health. Parkin is expressed in various tissues with significant levels in dopaminergic neurons in the brain. It is encoded by the PARK2 gene and has been linked to the regulation of mitochondrial quality and autophagy processes contributing to cellular homeostasis.
Biological function summary

Parkin is essential for the regulation of mitochondria through its involvement in the mitochondrial quality control system. It functions as part of a complex with other proteins that respond to mitochondrial damage by tagging them with ubiquitin molecules. This mechanism allows for the removal of defective mitochondria via mitophagy critical for preventing the accumulation of damaged cellular components.

Pathways

Parkin interacts with pathways involved in the cellular stress response particularly the PINK1 (PTEN Induced Kinase

  1. pathway. PINK1 phosphorylates Parkin activating it to label damaged mitochondria. Another critical pathway involves proteasomal degradation where Parkin collaborates with Ubiquitin to manage protein turnover. These pathways highlight its relationships with other cellular stress-regulating proteins enhancing our understanding of its roles in maintaining cellular integrity.
Mutations in the gene coding for Parkin are linked to Parkinson's disease (PD) and some forms of juvenile autosomal recessive parkinsonism. The Parkin protein's dysfunctional activity leads to impaired mitochondrial management and protein aggregation in neurons contributing significantly to neurodegenerative disease. In conditions such as PD Parkin interacts with other proteins such as PINK1 reinforcing its role in mitochondrial protection and indicating the protein's importance in disease progression and potential therapeutic targeting.

Specifications

Form

Liquid

Additional notes

ab177625 was purified using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.

General info

Function

Functions within a multiprotein E3 ubiquitin ligase complex, catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins (PubMed : 10888878, PubMed : 10973942, PubMed : 11431533, PubMed : 12150907, PubMed : 12628165, PubMed : 15105460, PubMed : 16135753, PubMed : 21376232, PubMed : 21532592, PubMed : 22396657, PubMed : 23620051, PubMed : 23754282, PubMed : 24660806, PubMed : 24751536, PubMed : 29311685, PubMed : 32047033). Substrates include SYT11 and VDAC1 (PubMed : 29311685, PubMed : 32047033). Other substrates are BCL2, CCNE1, GPR37, RHOT1/MIRO1, MFN1, MFN2, STUB1, SNCAIP, SEPTIN5, TOMM20, USP30, ZNF746, MIRO1 and AIMP2 (PubMed : 10888878, PubMed : 10973942, PubMed : 11431533, PubMed : 12150907, PubMed : 12628165, PubMed : 15105460, PubMed : 16135753, PubMed : 21376232, PubMed : 21532592, PubMed : 22396657, PubMed : 23620051, PubMed : 23754282, PubMed : 24660806, PubMed : 24751536). Mediates monoubiquitination as well as 'Lys-6', 'Lys-11', 'Lys-48'-linked and 'Lys-63'-linked polyubiquitination of substrates depending on the context (PubMed : 19229105, PubMed : 20889974, PubMed : 25474007, PubMed : 25621951, PubMed : 32047033). Participates in the removal and/or detoxification of abnormally folded or damaged protein by mediating 'Lys-63'-linked polyubiquitination of misfolded proteins such as PARK7 : 'Lys-63'-linked polyubiquitinated misfolded proteins are then recognized by HDAC6, leading to their recruitment to aggresomes, followed by degradation (PubMed : 17846173, PubMed : 19229105). Mediates 'Lys-63'-linked polyubiquitination of a 22 kDa O-linked glycosylated isoform of SNCAIP, possibly playing a role in Lewy-body formation (PubMed : 11431533, PubMed : 11590439, PubMed : 15105460, PubMed : 15728840, PubMed : 19229105). Mediates monoubiquitination of BCL2, thereby acting as a positive regulator of autophagy (PubMed : 20889974). Protects against mitochondrial dysfunction during cellular stress, by acting downstream of PINK1 to coordinate mitochondrial quality control mechanisms that remove and replace dysfunctional mitochondrial components (PubMed : 11439185, PubMed : 18957282, PubMed : 19029340, PubMed : 19966284, PubMed : 21376232, PubMed : 22082830, PubMed : 22396657, PubMed : 23620051, PubMed : 23933751, PubMed : 24660806, PubMed : 24784582, PubMed : 24896179, PubMed : 25474007, PubMed : 25527291, PubMed : 32047033). Depending on the severity of mitochondrial damage and/or dysfunction, activity ranges from preventing apoptosis and stimulating mitochondrial biogenesis to regulating mitochondrial dynamics and eliminating severely damaged mitochondria via mitophagy (PubMed : 11439185, PubMed : 19029340, PubMed : 19801972, PubMed : 19966284, PubMed : 21376232, PubMed : 22082830, PubMed : 22396657, PubMed : 23620051, PubMed : 23685073, PubMed : 23933751, PubMed : 24896179, PubMed : 25527291, PubMed : 32047033, PubMed : 33499712). Activation and recruitment onto the outer membrane of damaged/dysfunctional mitochondria (OMM) requires PINK1-mediated phosphorylation of both PRKN and ubiquitin (PubMed : 24660806, PubMed : 24784582, PubMed : 25474007, PubMed : 25527291). After mitochondrial damage, functions with PINK1 to mediate the decision between mitophagy or preventing apoptosis by inducing either the poly- or monoubiquitination of VDAC1, respectively; polyubiquitination of VDAC1 promotes mitophagy, while monoubiquitination of VDAC1 decreases mitochondrial calcium influx which ultimately inhibits apoptosis (PubMed : 27534820, PubMed : 32047033). When cellular stress results in irreversible mitochondrial damage, promotes the autophagic degradation of dysfunctional depolarized mitochondria (mitophagy) by promoting the ubiquitination of mitochondrial proteins such as TOMM20, RHOT1/MIRO1, MFN1 and USP30 (PubMed : 19029340, PubMed : 19966284, PubMed : 21753002, PubMed : 22396657, PubMed : 23620051, PubMed : 23685073, PubMed : 23933751, PubMed : 24896179, PubMed : 25527291). Preferentially assembles 'Lys-6'-, 'Lys-11'- and 'Lys-63'-linked polyubiquitin chains, leading to mitophagy (PubMed : 25621951, PubMed : 32047033). The PINK1-PRKN pathway also promotes fission of damaged mitochondria by PINK1-mediated phosphorylation which promotes the PRKN-dependent degradation of mitochondrial proteins involved in fission such as MFN2 (PubMed : 23620051). This prevents the refusion of unhealthy mitochondria with the mitochondrial network or initiates mitochondrial fragmentation facilitating their later engulfment by autophagosomes (PubMed : 23620051). Regulates motility of damaged mitochondria via the ubiquitination and subsequent degradation of MIRO1 and MIRO2; in motor neurons, this likely inhibits mitochondrial intracellular anterograde transport along the axons which probably increases the chance of the mitochondria undergoing mitophagy in the soma (PubMed : 22396657). Involved in mitochondrial biogenesis via the 'Lys-48'-linked polyubiquitination of transcriptional repressor ZNF746/PARIS which leads to its subsequent proteasomal degradation and allows activation of the transcription factor PPARGC1A (PubMed : 21376232). Limits the production of reactive oxygen species (ROS) (PubMed : 18541373). Regulates cyclin-E during neuronal apoptosis (PubMed : 12628165). In collaboration with CHPF isoform 2, may enhance cell viability and protect cells from oxidative stress (PubMed : 22082830). Independently of its ubiquitin ligase activity, protects from apoptosis by the transcriptional repression of p53/TP53 (PubMed : 19801972). May protect neurons against alpha synuclein toxicity, proteasomal dysfunction, GPR37 accumulation, and kainate-induced excitotoxicity (PubMed : 11439185). May play a role in controlling neurotransmitter trafficking at the presynaptic terminal and in calcium-dependent exocytosis. May represent a tumor suppressor gene (PubMed : 12719539).

Sequence similarities

Belongs to the RBR family. Parkin subfamily.

Post-translational modifications

ISGylated. Conjugated to ubiquitin-like protein ISG15 upon IFN-beta stimulation. ISGylation positively regulates its E3 ligase activity.. Auto-ubiquitinates in an E2-dependent manner leading to its own degradation (PubMed:19229105, PubMed:23770917, PubMed:25474007). Also polyubiquitinated by RNF41 for proteasomal degradation (PubMed:19229105).. S-nitrosylated. The inhibition of PRKN ubiquitin E3 ligase activity by S-nitrosylation could contribute to the degenerative process in PD by impairing the ubiquitination of PRKN substrates.. Phosphorylated (PubMed:18957282, PubMed:23754282, PubMed:24660806, PubMed:24784582, PubMed:25474007). Activation requires phosphorylation at Ser-65 by PINK1 and binding to PINK1 phosphorylated ubiquitin (PubMed:18957282, PubMed:23754282, PubMed:24660806, PubMed:24784582, PubMed:25474007). Phosphorylation at Thr-175 by PINK1 and at Thr-217 is important for mitochondrial localization (PubMed:18957282).

Subcellular localisation

Nucleus

Product protocols

Target data

Functions within a multiprotein E3 ubiquitin ligase complex, catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins (PubMed : 10888878, PubMed : 10973942, PubMed : 11431533, PubMed : 12150907, PubMed : 12628165, PubMed : 15105460, PubMed : 16135753, PubMed : 21376232, PubMed : 21532592, PubMed : 22396657, PubMed : 23620051, PubMed : 23754282, PubMed : 24660806, PubMed : 24751536, PubMed : 29311685, PubMed : 32047033). Substrates include SYT11 and VDAC1 (PubMed : 29311685, PubMed : 32047033). Other substrates are BCL2, CCNE1, GPR37, RHOT1/MIRO1, MFN1, MFN2, STUB1, SNCAIP, SEPTIN5, TOMM20, USP30, ZNF746, MIRO1 and AIMP2 (PubMed : 10888878, PubMed : 10973942, PubMed : 11431533, PubMed : 12150907, PubMed : 12628165, PubMed : 15105460, PubMed : 16135753, PubMed : 21376232, PubMed : 21532592, PubMed : 22396657, PubMed : 23620051, PubMed : 23754282, PubMed : 24660806, PubMed : 24751536). Mediates monoubiquitination as well as 'Lys-6', 'Lys-11', 'Lys-48'-linked and 'Lys-63'-linked polyubiquitination of substrates depending on the context (PubMed : 19229105, PubMed : 20889974, PubMed : 25474007, PubMed : 25621951, PubMed : 32047033). Participates in the removal and/or detoxification of abnormally folded or damaged protein by mediating 'Lys-63'-linked polyubiquitination of misfolded proteins such as PARK7 : 'Lys-63'-linked polyubiquitinated misfolded proteins are then recognized by HDAC6, leading to their recruitment to aggresomes, followed by degradation (PubMed : 17846173, PubMed : 19229105). Mediates 'Lys-63'-linked polyubiquitination of a 22 kDa O-linked glycosylated isoform of SNCAIP, possibly playing a role in Lewy-body formation (PubMed : 11431533, PubMed : 11590439, PubMed : 15105460, PubMed : 15728840, PubMed : 19229105). Mediates monoubiquitination of BCL2, thereby acting as a positive regulator of autophagy (PubMed : 20889974). Protects against mitochondrial dysfunction during cellular stress, by acting downstream of PINK1 to coordinate mitochondrial quality control mechanisms that remove and replace dysfunctional mitochondrial components (PubMed : 11439185, PubMed : 18957282, PubMed : 19029340, PubMed : 19966284, PubMed : 21376232, PubMed : 22082830, PubMed : 22396657, PubMed : 23620051, PubMed : 23933751, PubMed : 24660806, PubMed : 24784582, PubMed : 24896179, PubMed : 25474007, PubMed : 25527291, PubMed : 32047033). Depending on the severity of mitochondrial damage and/or dysfunction, activity ranges from preventing apoptosis and stimulating mitochondrial biogenesis to regulating mitochondrial dynamics and eliminating severely damaged mitochondria via mitophagy (PubMed : 11439185, PubMed : 19029340, PubMed : 19801972, PubMed : 19966284, PubMed : 21376232, PubMed : 22082830, PubMed : 22396657, PubMed : 23620051, PubMed : 23685073, PubMed : 23933751, PubMed : 24896179, PubMed : 25527291, PubMed : 32047033, PubMed : 33499712). Activation and recruitment onto the outer membrane of damaged/dysfunctional mitochondria (OMM) requires PINK1-mediated phosphorylation of both PRKN and ubiquitin (PubMed : 24660806, PubMed : 24784582, PubMed : 25474007, PubMed : 25527291). After mitochondrial damage, functions with PINK1 to mediate the decision between mitophagy or preventing apoptosis by inducing either the poly- or monoubiquitination of VDAC1, respectively; polyubiquitination of VDAC1 promotes mitophagy, while monoubiquitination of VDAC1 decreases mitochondrial calcium influx which ultimately inhibits apoptosis (PubMed : 27534820, PubMed : 32047033). When cellular stress results in irreversible mitochondrial damage, promotes the autophagic degradation of dysfunctional depolarized mitochondria (mitophagy) by promoting the ubiquitination of mitochondrial proteins such as TOMM20, RHOT1/MIRO1, MFN1 and USP30 (PubMed : 19029340, PubMed : 19966284, PubMed : 21753002, PubMed : 22396657, PubMed : 23620051, PubMed : 23685073, PubMed : 23933751, PubMed : 24896179, PubMed : 25527291). Preferentially assembles 'Lys-6'-, 'Lys-11'- and 'Lys-63'-linked polyubiquitin chains, leading to mitophagy (PubMed : 25621951, PubMed : 32047033). The PINK1-PRKN pathway also promotes fission of damaged mitochondria by PINK1-mediated phosphorylation which promotes the PRKN-dependent degradation of mitochondrial proteins involved in fission such as MFN2 (PubMed : 23620051). This prevents the refusion of unhealthy mitochondria with the mitochondrial network or initiates mitochondrial fragmentation facilitating their later engulfment by autophagosomes (PubMed : 23620051). Regulates motility of damaged mitochondria via the ubiquitination and subsequent degradation of MIRO1 and MIRO2; in motor neurons, this likely inhibits mitochondrial intracellular anterograde transport along the axons which probably increases the chance of the mitochondria undergoing mitophagy in the soma (PubMed : 22396657). Involved in mitochondrial biogenesis via the 'Lys-48'-linked polyubiquitination of transcriptional repressor ZNF746/PARIS which leads to its subsequent proteasomal degradation and allows activation of the transcription factor PPARGC1A (PubMed : 21376232). Limits the production of reactive oxygen species (ROS) (PubMed : 18541373). Regulates cyclin-E during neuronal apoptosis (PubMed : 12628165). In collaboration with CHPF isoform 2, may enhance cell viability and protect cells from oxidative stress (PubMed : 22082830). Independently of its ubiquitin ligase activity, protects from apoptosis by the transcriptional repression of p53/TP53 (PubMed : 19801972). May protect neurons against alpha synuclein toxicity, proteasomal dysfunction, GPR37 accumulation, and kainate-induced excitotoxicity (PubMed : 11439185). May play a role in controlling neurotransmitter trafficking at the presynaptic terminal and in calcium-dependent exocytosis. May represent a tumor suppressor gene (PubMed : 12719539).
See full target information PRKN

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Journal of assisted reproduction and genetics 42:923-936 PubMed39810070

2025

miR-361-5p regulates SLC25A24 to maintain mitochondrial function and alleviate granulosa cell dysfunction in diminished ovarian reserve.

Applications

Unspecified application

Species

Unspecified reactive species

Jinyuan Xu,Yan Jia
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com