JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152593

Recombinant Human PCBP2/hnRNP E2 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human PCBP2/hnRNP E2 protein (GST tag N-Terminus) is a Human Fragment protein, in the 174 to 283 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

Poly(rC)-binding protein 2, Alpha-CP2, Heterogeneous nuclear ribonucleoprotein E2, hnRNP E2, PCBP2

1 Images
SDS-PAGE - Recombinant Human PCBP2/hnRNP E2 protein (GST tag N-Terminus) (AB152593)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human PCBP2/hnRNP E2 protein (GST tag N-Terminus) (AB152593)

ab152593 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

Q15366

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"VTIPYRPKPSSSPVIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQPDLTKLHQLAMQQSHFPMTHGNTGFSGIESSSPEVKGYWAGLDASAQ","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":283,"aminoAcidStart":174,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q15366","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

PCBP2 also known as hnRNP E2 is a poly(C) binding protein with a molecular weight of approximately 38 kDa. It binds to single-stranded poly(C) sequences in RNA molecules. PCBP2 is widely expressed in various tissues where it modulates pre-mRNA splicing RNA stability and translation. It functions as part of ribonucleoprotein complexes and is known for its role in regulating mRNA transport and localization within the cell.
Biological function summary

A significant function of PCBP2 involves the maintenance of mRNA stability particularly for certain growth factor and cytokine mRNAs. PCBP2 is part of the ribonucleosome complex supporting various cellular processes by regulating the turnover of target mRNAs. Through these actions it helps control cellular proliferation and immune responses. PCBP2 collaborates with several other proteins influencing cellular adaptation to stress and changes in the environment.

Pathways

PCBP2 plays key roles in the Wnt signaling and Toll-like receptor pathways. In the Wnt signaling pathway its interaction with mRNA targets such as beta-catenin is significant for cellular communication processes. In the Toll-like receptor pathway it works alongside proteins like MyD88 modulating innate immune responses to pathogens. PCBP2's participation in these pathways highlights its versatility and influence on cellular and systemic communication networks.

Researchers have linked PCBP2 to cancer particularly due to its involvement with oncogene regulation. Disruptions in the expression of PCBP2 can affect cell cycle control contributing to tumorigenesis. PCBP2 also connects with amyotrophic lateral sclerosis (ALS) through its interaction with proteins like TDP-43 which are critical in neurodegenerative disease pathways. Understanding PCBP2's function and its connections to these conditions remains important for developing therapeutic strategies.

Specifications

Form

Liquid

General info

Function

Single-stranded nucleic acid binding protein that binds preferentially to oligo dC (PubMed : 12414943, PubMed : 7607214). Major cellular poly(rC)-binding protein (PubMed : 12414943). Also binds poly(rU) (PubMed : 12414943). Acts as a negative regulator of antiviral signaling (PubMed : 19881509, PubMed : 35322803). Negatively regulates cellular antiviral responses mediated by MAVS signaling (PubMed : 19881509). It acts as an adapter between MAVS and the E3 ubiquitin ligase ITCH, therefore triggering MAVS ubiquitination and degradation (PubMed : 19881509). Negativeley regulates the cGAS-STING pathway via interaction with CGAS, preventing the formation of liquid-like droplets in which CGAS is activated (PubMed : 35322803). Together with PCBP1, required for erythropoiesis, possibly by regulating mRNA splicing (By similarity).. (Microbial infection) In case of infection by poliovirus, binds to the viral internal ribosome entry site (IRES) and stimulates the IRES-mediated translation (PubMed : 12414943, PubMed : 24371074). Also plays a role in initiation of viral RNA replication in concert with the viral protein 3CD (PubMed : 12414943).

Post-translational modifications

Phosphorylated. The non-phosphorylated form(s) exhibited the strongest poly(rC)-binding activity.. (Microbial infection) Proteolytically cleaved by picornavirus proteinase 3CD.

Product protocols

Target data

Single-stranded nucleic acid binding protein that binds preferentially to oligo dC (PubMed : 12414943, PubMed : 7607214). Major cellular poly(rC)-binding protein (PubMed : 12414943). Also binds poly(rU) (PubMed : 12414943). Acts as a negative regulator of antiviral signaling (PubMed : 19881509, PubMed : 35322803). Negatively regulates cellular antiviral responses mediated by MAVS signaling (PubMed : 19881509). It acts as an adapter between MAVS and the E3 ubiquitin ligase ITCH, therefore triggering MAVS ubiquitination and degradation (PubMed : 19881509). Negativeley regulates the cGAS-STING pathway via interaction with CGAS, preventing the formation of liquid-like droplets in which CGAS is activated (PubMed : 35322803). Together with PCBP1, required for erythropoiesis, possibly by regulating mRNA splicing (By similarity).. (Microbial infection) In case of infection by poliovirus, binds to the viral internal ribosome entry site (IRES) and stimulates the IRES-mediated translation (PubMed : 12414943, PubMed : 24371074). Also plays a role in initiation of viral RNA replication in concert with the viral protein 3CD (PubMed : 12414943).
See full target information PCBP2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com