JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB307191

Recombinant Human PCNA protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human PCNA protein (His tag) is a Human Full Length protein, in the 1 to 261 aa range, expressed in Escherichia coli, with >95%, <0.1 EU/mg endotoxin level, suitable for SDS-PAGE, HPLC, Mass Spec.

View Alternative Names

Proliferating cell nuclear antigen, PCNA, Cyclin

3 Images
Mass Spectrometry - Recombinant Human PCNA protein (His tag) (AB307191)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human PCNA protein (His tag) (AB307191)

Mass determination by ESI-TOF. Predicted MW is 29832.96 Da (+/- 10 Da by ESI-TOF). Observed MW is 29832.64 Da.

SDS-PAGE - Recombinant Human PCNA protein (His tag) (AB307191)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human PCNA protein (His tag) (AB307191)

SDS-page analysis of ab307191

HPLC - Recombinant Human PCNA protein (His tag) (AB307191)
  • HPLC

Supplier Data

HPLC - Recombinant Human PCNA protein (His tag) (AB307191)

HPLC analysis of ab307191

Key facts

Purity

>95% HPLC

Endotoxin level

<0.1 EU/mg

Expression system

Escherichia coli

Tags

His tag C-Terminus

Applications

Mass Spec, SDS-PAGE, HPLC

applications

Biologically active

No

Accession

P12004

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS","proteinLength":"Full Length","predictedMolecularWeight":"29.83 kDa","actualMolecularWeight":"29.83 kDa","aminoAcidEnd":261,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P12004","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

PCNA or Proliferating Cell Nuclear Antigen functions as a sliding clamp for DNA polymerases during DNA replication. This important role enables it to coordinate the orderly duplication of the genome by increasing the processivity of DNA polymerase Δ. PCNA weighs approximately 29 kDa and forms a homotrimeric ring structure. It is expressed in the nucleus of cells often found abundantly in proliferating cells. Aside from its main name some people also refer to it as PC10.
Biological function summary

This protein serves a core function in cell cycle regulation and DNA repair. PCNA acts as a scaffold for the assembly of numerous proteins involved in DNA processing forming part of the replication fork complex. It interacts with cyclins and cyclin-dependent kinases (CDKs) linking DNA synthesis to cell cycle progression. Furthermore PCNA partners with proteins involved in DNA mismatch repair base excision repair and nucleotide excision repair.

Pathways

PCNA is integral in the DNA replication and repair pathways. It closely associates with the p21 protein which regulates the cell cycle by inhibiting cyclin-CDK complexes upon DNA damage. PCNA also plays a part in the ubiquitin-proteasome pathway where its modification by ubiquitin impacts how cells respond to DNA damage. This modification recruits specific proteins for DNA repair highlighting its central role in maintaining genomic stability.

PCNA is linked to cancer and autoimmune diseases. Its overexpression is common in various cancers reflecting its role in cell proliferation and the cell cycle. PCNA antibodies are sometimes found in the serum of patients with systemic lupus erythematosus (SLE) a connection also related to alterations in the p21 protein pathway. The interaction between PCNA and disease-specific proteins emphasizes its importance in both cell proliferation and immune system disorders.

Specifications

Form

Lyophilized

Additional notes

SDS-PAGE >=95%

General info

Function

Auxiliary protein of DNA polymerase delta and epsilon, is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand (PubMed : 35585232). Induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. Has to be loaded onto DNA in order to be able to stimulate APEX2. Plays a key role in DNA damage response (DDR) by being conveniently positioned at the replication fork to coordinate DNA replication with DNA repair and DNA damage tolerance pathways (PubMed : 24939902). Acts as a loading platform to recruit DDR proteins that allow completion of DNA replication after DNA damage and promote postreplication repair : Monoubiquitinated PCNA leads to recruitment of translesion (TLS) polymerases, while 'Lys-63'-linked polyubiquitination of PCNA is involved in error-free pathway and employs recombination mechanisms to synthesize across the lesion (PubMed : 24695737).

Sequence similarities

Belongs to the PCNA family.

Post-translational modifications

Phosphorylated. Phosphorylation at Tyr-211 by EGFR stabilizes chromatin-associated PCNA.. Acetylated by CREBBP and p300/EP300; preferentially acetylated by CREBBP on Lys-80, Lys-13 and Lys-14 and on Lys-77 by p300/EP300 upon loading on chromatin in response to UV irradiation (PubMed:19419956, PubMed:24939902). Lysine acetylation disrupts association with chromatin, hence promoting PCNA ubiquitination and proteasomal degradation in response to UV damage in a CREBBP- and EP300-dependent manner (PubMed:24939902). Acetylation disrupts interaction with NUDT15 and promotes degradation (PubMed:19419956).. Ubiquitinated (PubMed:20227374, PubMed:24939902). Following DNA damage, can be either monoubiquitinated to stimulate direct bypass of DNA lesions by specialized DNA polymerases or polyubiquitinated to promote recombination-dependent DNA synthesis across DNA lesions by template switching mechanisms. Following induction of replication stress, monoubiquitinated by the UBE2B-RAD18 complex on Lys-164, leading to recruit translesion (TLS) polymerases, which are able to synthesize across DNA lesions in a potentially error-prone manner. An error-free pathway also exists and requires non-canonical polyubiquitination on Lys-164 through 'Lys-63' linkage of ubiquitin moieties by the E2 complex UBE2N-UBE2V2 and the E3 ligases, HLTF, RNF8 and SHPRH. This error-free pathway, also known as template switching, employs recombination mechanisms to synthesize across the lesion, using as a template the undamaged, newly synthesized strand of the sister chromatid. Monoubiquitination at Lys-164 also takes place in undamaged proliferating cells, and is mediated by the DCX(DTL) complex, leading to enhance PCNA-dependent translesion DNA synthesis. Sumoylated during S phase.. Methylated on glutamate residues by ARMT1/C6orf211.

Subcellular localisation

Nucleus

Product protocols

Target data

Auxiliary protein of DNA polymerase delta and epsilon, is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand (PubMed : 35585232). Induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. Has to be loaded onto DNA in order to be able to stimulate APEX2. Plays a key role in DNA damage response (DDR) by being conveniently positioned at the replication fork to coordinate DNA replication with DNA repair and DNA damage tolerance pathways (PubMed : 24939902). Acts as a loading platform to recruit DDR proteins that allow completion of DNA replication after DNA damage and promote postreplication repair : Monoubiquitinated PCNA leads to recruitment of translesion (TLS) polymerases, while 'Lys-63'-linked polyubiquitination of PCNA is involved in error-free pathway and employs recombination mechanisms to synthesize across the lesion (PubMed : 24695737).
See full target information PCNA

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com