JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB167713

Recombinant human PD-L1 protein (Active)

Be the first to review this product! Submit a review

|

(6 Publications)

Recombinant human PD-L1 protein (Active) is a Human Fragment protein, in the 19 to 238 aa range, expressed in HEK 293 cells, with >98%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, HPLC, FuncS.

View Alternative Names

CD274, B7H1, PDCD1L1, PDCD1LG1, PDL1, Programmed cell death 1 ligand 1, PD-L1, PDCD1 ligand 1, Programmed death ligand 1, hPD-L1, B7 homolog 1, B7-H1

8 Images
Functional Studies - Recombinant human PD-L1 protein (Active) (AB167713)
  • FuncS

Supplier Data

Functional Studies - Recombinant human PD-L1 protein (Active) (AB167713)

Anti-Human PD-L1 Mab (Human IgG1), captured on CM5 chip via anti-human IgG Fc antibodies surface, binds ab167713 with an affinity constant of 0.286 nM, as determined in a SPR assay (Biacore T200) (Routinely tested).

Functional Studies - Recombinant human PD-L1 protein (Active) (AB167713)
  • FuncS

Supplier Data

Functional Studies - Recombinant human PD-L1 protein (Active) (AB167713)

Human PD-1, Fc Tag (ab221398), captured on CM5 chip via anti-human IgG Fc antibody, binds ab167713 with an affinity constant of 3.6 μM, as determined in an SPR assay (Biacore T200).

Functional Studies - Recombinant human PD-L1 protein (Active) (AB167713)
  • FuncS

Unknown

Functional Studies - Recombinant human PD-L1 protein (Active) (AB167713)

The purity of Human PD-L1 (His Tag) (HPLC verified) was greater than 90% as determined by SEC-HPLC.

Functional Studies - Recombinant human PD-L1 protein (Active) (AB167713)
  • FuncS

Supplier Data

Functional Studies - Recombinant human PD-L1 protein (Active) (AB167713)

Loaded Recombinant human PD1 protein (Fc Chimera Active) ab221398 on ProteinA Biosensor, can bind Human PD-L1, His Tag ab167713 with an affinity constant of 5.3 μM as determined in BLI assay.

Functional Studies - Recombinant human PD-L1 protein (Active) (AB167713)
  • FuncS

Supplier Data

Functional Studies - Recombinant human PD-L1 protein (Active) (AB167713)

Immobilized ab167713 at 1 μg/mL (100 μL/well) binds Anti-Human PD-L1 MAb (Human IgG1).

Linear range of 0.1-3 ng/mL (QC tested).

Functional Studies - Recombinant human PD-L1 protein (Active) (AB167713)
  • FuncS

Supplier Data

Functional Studies - Recombinant human PD-L1 protein (Active) (AB167713)

Immobilized ab167713 on Anti-His Tag (C-term) Antibody, precoated (0.1 μg/well) plate, binds Human PD-1, Mouse IgG2a Fc Tag (HPLC-verified), at 5 μg/mL (100 μL/well).

Linear range of 10-78 ng/mL (Routinely tested).

Functional Studies - Recombinant human PD-L1 protein (Active) (AB167713)
  • FuncS

Supplier Data

Functional Studies - Recombinant human PD-L1 protein (Active) (AB167713)

Biotinylated Human PD-1, Fc Tag (ab246137) binds Recombinant human PD-L1 protein ab167713 at 1 μg/mL (5μL/well).

Linear range of 0.02-0.625 μg/mL as determined in a alphaLISA homogeneous assay (Routinely tested).

SDS-PAGE - Recombinant human PD-L1 protein (Active) (AB167713)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human PD-L1 protein (Active) (AB167713)

Reduced ab167713 on SDS-PAGE, stained overnight with Coomassie Blue.

The purity of the protein is greater than 98%.

The protein migrates as 30-35 kDa under reducing conditions, due to glycosylation.

Key facts

Purity

>98% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

His tag C-Terminus

Applications

HPLC, FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Immobilized ab167713 on Anti-His Tag (C-term) Antibody, precoated (0.1 μg/well) plate, binds Human PD-1, Mouse IgG2a Fc Tag (HPLC-verified), at 5 μg/mL (100 μL/well) with a linear range of 10-78 ng/mL.

Accession

Q9NZQ7

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute with sterile deionized water to a concentration of 400 µg/ml.

Storage buffer

pH: 7.4 Constituents: PBS, 5% Trehalose

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

For a recombinant rabbit monoclonal antibody to PD-L1 in IHC usage and KO validated, see ab205921 (clone 28-8)

For a recombinant rabbit monoclonal antibody to PD-L1 in WB and ICC/IF usage, - see ab174838 (clone EPR1161(2))

Sequence info

[{"sequence":"FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER","proteinLength":"Fragment","predictedMolecularWeight":"26 kDa","actualMolecularWeight":null,"aminoAcidEnd":238,"aminoAcidStart":19,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q9NZQ7","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

PD-L1 also known as Programmed Death-Ligand 1 or CD274 is a protein involved in immune modulation. Mechanically PD-L1 interacts with its receptors particularly PD-1 to regulate cellular immune responses. This transmembrane protein has a calculated molecular weight of approximately 33 kDa. PD-L1 is expressed on various cell types including tumor cells and immune cells such as dendritic cells macrophages and B cells. Its expression is often upregulated in response to inflammatory cytokines.
Biological function summary

PD-L1 plays a central role in immune evasion mechanisms utilized by tumors. It is not part of a larger protein complex but directly interacts with PD-1 and CD80. When PD-L1 binds to PD-1 it sends inhibitory signals leading to decreased T cell activation and proliferation allowing cancer cells to avoid immune destruction. PD-L1 expression provides a mechanism for tumors to suppress immune surveillance facilitating tumor progression.

Pathways

PD-L1 is integral to the immune checkpoint pathway which is an important regulator of immune response. The interaction between PD-L1 and PD-1 provides a mechanism for immune tolerance which is part of the broader adaptive immune system pathway. PD-L1 is related to other immune checkpoint proteins such as CTLA-4 in its function to limit autoreactivity and promote immune homeostasis.

PD-L1 is most associated with cancer particularly in tumors such as melanoma and non-small cell lung cancer. PD-L1 expression on tumor cells often correlates with poor prognosis. PD-L1 directly interacts with PD-1 in these cancers a target for immunotherapies such as checkpoint inhibitors which aim to block this interaction and restore immune activity against tumors. PD-L1 involvement extends to autoimmune disorders where altered expression can impact tolerance and lead to immune-related tissue damage.

Specifications

Form

Lyophilized

Additional notes

>90% as determined by SEC-HPLC.Purified by Immobilized metal affinity chromatography.

General info

Function

Plays a critical role in induction and maintenance of immune tolerance to self (PubMed : 11015443, PubMed : 28813410, PubMed : 28813417, PubMed : 31399419). As a ligand for the inhibitory receptor PDCD1/PD-1, modulates the activation threshold of T-cells and limits T-cell effector response (PubMed : 11015443, PubMed : 28813410, PubMed : 28813417, PubMed : 36727298). Through a yet unknown activating receptor, may costimulate T-cell subsets that predominantly produce interleukin-10 (IL10) (PubMed : 10581077). Can also act as a transcription coactivator : in response to hypoxia, translocates into the nucleus via its interaction with phosphorylated STAT3 and promotes transcription of GSDMC, leading to pyroptosis (PubMed : 32929201).. The PDCD1-mediated inhibitory pathway is exploited by tumors to attenuate anti-tumor immunity and escape destruction by the immune system, thereby facilitating tumor survival (PubMed : 28813410, PubMed : 28813417). The interaction with PDCD1/PD-1 inhibits cytotoxic T lymphocytes (CTLs) effector function (By similarity). The blockage of the PDCD1-mediated pathway results in the reversal of the exhausted T-cell phenotype and the normalization of the anti-tumor response, providing a rationale for cancer immunotherapy (By similarity).

Sequence similarities

Belongs to the immunoglobulin superfamily. BTN/MOG family.

Post-translational modifications

Ubiquitinated; STUB1 likely mediates polyubiquitination of PD-L1/CD274 triggering its degradation (PubMed:28813410). Ubiquitinated by MARCHF8; leading to degradation (PubMed:34183449). Deubiquitinated by USP22; leading to stabilization (PubMed:31399419).

Product protocols

Target data

Plays a critical role in induction and maintenance of immune tolerance to self (PubMed : 11015443, PubMed : 28813410, PubMed : 28813417, PubMed : 31399419). As a ligand for the inhibitory receptor PDCD1/PD-1, modulates the activation threshold of T-cells and limits T-cell effector response (PubMed : 11015443, PubMed : 28813410, PubMed : 28813417, PubMed : 36727298). Through a yet unknown activating receptor, may costimulate T-cell subsets that predominantly produce interleukin-10 (IL10) (PubMed : 10581077). Can also act as a transcription coactivator : in response to hypoxia, translocates into the nucleus via its interaction with phosphorylated STAT3 and promotes transcription of GSDMC, leading to pyroptosis (PubMed : 32929201).. The PDCD1-mediated inhibitory pathway is exploited by tumors to attenuate anti-tumor immunity and escape destruction by the immune system, thereby facilitating tumor survival (PubMed : 28813410, PubMed : 28813417). The interaction with PDCD1/PD-1 inhibits cytotoxic T lymphocytes (CTLs) effector function (By similarity). The blockage of the PDCD1-mediated pathway results in the reversal of the exhausted T-cell phenotype and the normalization of the anti-tumor response, providing a rationale for cancer immunotherapy (By similarity).
See full target information CD274

Publications (6)

Recent publications for all applications. Explore the full list and refine your search

Advanced science (Weinheim, Baden-Wurttemberg, Germany) 11:e2309917 PubMed38520717

2024

Design of PD-L1-Targeted Lipid Nanoparticles to Turn on PTEN for Efficient Cancer Therapy.

Applications

Unspecified application

Species

Unspecified reactive species

Yelee Kim,Jiwoong Choi,Eun Hye Kim,Wonbeom Park,Hochung Jang,Yeongji Jang,Sung-Gil Chi,Dae-Hyuk Kweon,Kyuri Lee,Sun Hwa Kim,Yoosoo Yang

Journal of immunology (Baltimore, Md. : 1950) 212:917-927 PubMed38214607

2024

Efficacy against Lung Cancer Is Augmented by Combining Aberrantly N-Glycosylated T Cells with a Chimeric Antigen Receptor Targeting Fragile X Mental Retardation 1 Neighbor.

Applications

Unspecified application

Species

Unspecified reactive species

Toshihiko Toyofuku,Takako Ishikawa,Satoshi Nojima,Atsushi Kumanogoh

Molecular therapy : the journal of the American Society of Gene Therapy 31:2929-2947 PubMed37515321

2023

Targeting leucine-rich repeat serine/threonine-protein kinase 2 sensitizes pancreatic ductal adenocarcinoma to anti-PD-L1 immunotherapy.

Applications

Unspecified application

Species

Unspecified reactive species

Kang Sun,Xiaozhen Zhang,Mengyi Lao,Lihong He,Sicheng Wang,Hanshen Yang,Jian Xu,Jianghui Tang,Zhengtao Hong,Jinyuan Song,Chengxiang Guo,Muchun Li,Xinyuan Liu,Yan Chen,Hanjia Zhang,Jingxing Zhou,Jieru Lin,Sirui Zhang,Yifan Hong,Jinyan Huang,Tingbo Liang,Xueli Bai

International journal of molecular sciences 24: PubMed36982608

2023

Turning a Tumor Microenvironment Pitfall into Opportunity: Discovery of Benzamidoxime as PD-L1 Ligand with pH-Dependent Potency.

Applications

Unspecified application

Species

Unspecified reactive species

Elisa Bianconi,Alessandra Riccio,Luana Ruta,Carlo Bigiotti,Andrea Carotti,Sonia Moretti,Bruno Cerra,Antimo Gioiello,Simone Ferlin,Efisio Puxeddu,Antonio Macchiarulo

International journal of molecular sciences 22: PubMed34948105

2021

Cell Penetrating Peptide-Based Self-Assembly for PD-L1 Targeted Tumor Regression.

Applications

Unspecified application

Species

Unspecified reactive species

Feng Guo,Junfeng Ke,Zhengdong Fu,Wenzhao Han,Liping Wang

ChemMedChem 16:568-577 PubMed33085193

2020

The Stone Guest: How Does pH Affect Binding Properties of PD-1/PD-L1 Inhibitors?

Applications

Unspecified application

Species

Unspecified reactive species

Alessandra Riccio,Alice Coletti,Daniela Dolciami,Andrea Mammoli,Bruno Cerra,Sonia Moretti,Antimo Gioiello,Simone Ferlin,Efisio Puxeddu,Antonio Macchiarulo
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com