JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB104605

Recombinant Human PDCD6/ALG-2 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human PDCD6/ALG-2 protein is a Human Full Length protein, in the 1 to 191 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

ALG2, PDCD6, Programmed cell death protein 6, Apoptosis-linked gene 2 protein homolog, ALG-2

1 Images
SDS-PAGE - Recombinant Human PDCD6/ALG-2 protein (AB104605)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human PDCD6/ALG-2 protein (AB104605)

15% SDS-PAGE showing ab104605 (3 μg) at approximately 24 kDa.

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

O75340

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 3.5 Constituents: 40% Glycerol (glycerin, glycerine), 0.294% Sodium citrate

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Previously labelled as PDCD6.

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV","proteinLength":"Full Length","predictedMolecularWeight":"24 kDa","actualMolecularWeight":null,"aminoAcidEnd":191,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O75340","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

PDCD6 also known as ALG-2 is a protein with a molecular mass of about 22 kDa. It is expressed widely in human tissues with high levels observed in the thymus and spleen. The protein acts as a calcium-binding molecule interacting with other proteins in a calcium-dependent manner. PDCD6 has alternate names including ALG-15 and ALG-30 referencing its expression in certain cell types and conditions. The protein's role as a mediator in apoptotic cell death is well-known making it of significant interest to those studying cell death mechanisms.
Biological function summary

The function of PDCD6 involves its participation in calcium signaling pathways. This protein is part of a larger complex involving T-cell receptor signaling and also influences the Fas ligand-mediated apoptosis pathway. PDCD6 achieves its regulatory roles through interactions with various proteins such as MA3Ps. As a calcium-binding protein ALG-2 modulates calcium homeostasis which is critical for maintaining cellular functions including cell proliferation differentiation and programmed cell death.

Pathways

The involvement of PDCD6 in apoptosis is significant. It works in coordination with pathway proteins such as caspases and fas-associated proteins influencing cell death signaling. In addition PDCD6's ability to bind calcium allows it to fit into the broader intracellular signaling network placing it in connection with MAPK pathways essential for cellular responses to stress and growth signals. ALG protein interactions underline PDCD6's influence across apoptosis and signaling pathways.

PDCD6 links to pathological states like cancer and neurodegenerative disorders. Increased expression or altered function can impact apoptosis leading to uncontrolled cell growth in cancers or heightened cell death in neurodegenerative conditions. Additionally PDCD6 shows associations with proteins like anti-ALG and ALG protein variants influencing pathological processes in lymphomas and Alzheimer's disease. Understanding PDCD6's role gives insights into therapeutic strategies targeting calcium-dependent signaling and apoptotic regulation.

Specifications

Form

Liquid

Additional notes

ab104605 is purified using conventional chromatography techniques.

General info

Function

Calcium sensor that plays a key role in processes such as endoplasmic reticulum (ER)-Golgi vesicular transport, endosomal biogenesis or membrane repair. Acts as an adapter that bridges unrelated proteins or stabilizes weak protein-protein complexes in response to calcium : calcium-binding triggers exposure of apolar surface, promoting interaction with different sets of proteins thanks to 3 different hydrophobic pockets, leading to translocation to membranes (PubMed : 20691033, PubMed : 25667979). Involved in ER-Golgi transport by promoting the association between PDCD6IP and TSG101, thereby bridging together the ESCRT-III and ESCRT-I complexes (PubMed : 19520058). Together with PEF1, acts as a calcium-dependent adapter for the BCR(KLHL12) complex, a complex involved in ER-Golgi transport by regulating the size of COPII coats (PubMed : 27716508). In response to cytosolic calcium increase, the heterodimer formed with PEF1 interacts with, and bridges together the BCR(KLHL12) complex and SEC31 (SEC31A or SEC31B), promoting monoubiquitination of SEC31 and subsequent collagen export, which is required for neural crest specification (PubMed : 27716508). Involved in the regulation of the distribution and function of MCOLN1 in the endosomal pathway (PubMed : 19864416). Promotes localization and polymerization of TFG at endoplasmic reticulum exit site (PubMed : 27813252). Required for T-cell receptor-, Fas-, and glucocorticoid-induced apoptosis (By similarity). May mediate Ca(2+)-regulated signals along the death pathway : interaction with DAPK1 can accelerate apoptotic cell death by increasing caspase-3 activity (PubMed : 16132846). Its role in apoptosis may however be indirect, as suggested by knockout experiments (By similarity). May inhibit KDR/VEGFR2-dependent angiogenesis; the function involves inhibition of VEGF-induced phosphorylation of the Akt signaling pathway (PubMed : 21893193). In case of infection by HIV-1 virus, indirectly inhibits HIV-1 production by affecting viral Gag expression and distribution (PubMed : 27784779).. Isoform 2. Has a lower Ca(2+) affinity than isoform 1 (By similarity).

Subcellular localisation

Nucleus

Product protocols

Target data

Calcium sensor that plays a key role in processes such as endoplasmic reticulum (ER)-Golgi vesicular transport, endosomal biogenesis or membrane repair. Acts as an adapter that bridges unrelated proteins or stabilizes weak protein-protein complexes in response to calcium : calcium-binding triggers exposure of apolar surface, promoting interaction with different sets of proteins thanks to 3 different hydrophobic pockets, leading to translocation to membranes (PubMed : 20691033, PubMed : 25667979). Involved in ER-Golgi transport by promoting the association between PDCD6IP and TSG101, thereby bridging together the ESCRT-III and ESCRT-I complexes (PubMed : 19520058). Together with PEF1, acts as a calcium-dependent adapter for the BCR(KLHL12) complex, a complex involved in ER-Golgi transport by regulating the size of COPII coats (PubMed : 27716508). In response to cytosolic calcium increase, the heterodimer formed with PEF1 interacts with, and bridges together the BCR(KLHL12) complex and SEC31 (SEC31A or SEC31B), promoting monoubiquitination of SEC31 and subsequent collagen export, which is required for neural crest specification (PubMed : 27716508). Involved in the regulation of the distribution and function of MCOLN1 in the endosomal pathway (PubMed : 19864416). Promotes localization and polymerization of TFG at endoplasmic reticulum exit site (PubMed : 27813252). Required for T-cell receptor-, Fas-, and glucocorticoid-induced apoptosis (By similarity). May mediate Ca(2+)-regulated signals along the death pathway : interaction with DAPK1 can accelerate apoptotic cell death by increasing caspase-3 activity (PubMed : 16132846). Its role in apoptosis may however be indirect, as suggested by knockout experiments (By similarity). May inhibit KDR/VEGFR2-dependent angiogenesis; the function involves inhibition of VEGF-induced phosphorylation of the Akt signaling pathway (PubMed : 21893193). In case of infection by HIV-1 virus, indirectly inhibits HIV-1 production by affecting viral Gag expression and distribution (PubMed : 27784779).. Isoform 2. Has a lower Ca(2+) affinity than isoform 1 (By similarity).
See full target information PDCD6

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com