JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB259425

Recombinant human PDGF B protein (Active)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant human PDGF B protein (Active) is a Human Full Length protein, in the 82 to 190 aa range, expressed in HEK 293 cells, with >95%, < 0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, HPLC, Cell Culture.

View Alternative Names

PDGF2, SIS, PDGFB, Platelet-derived growth factor subunit B, PDGF subunit B, PDGF-2, Platelet-derived growth factor B chain, Platelet-derived growth factor beta polypeptide, Proto-oncogene c-Sis

4 Images
Mass Spectrometry - Recombinant human PDGF B protein (Active) (AB259425)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant human PDGF B protein (Active) (AB259425)

M + 0.41 Da (Calc. mass 12351.59 ).

The spectrum was recorded with a 6545XT AdvanceBio LC/Q-TOF (Agilent Technologies) and a MabPac RP column (42.1x50 mm, 4 μm, Thermo Scientific). 5 μL of purified protein was injected and the gradient run from 85 % water : FA (99.9 : 0.1 v/v) and 15 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) to 55 % water : FA (99.9 : 0.1 v/v) and 45 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 2.5 min. Flow rate was 0.4 mL/min and the column compartment temperature was 60 °C. Data was analysed and deconvoluted using the Bioconfirm software (Agilent Technologies).

Functional Studies - Recombinant human PDGF B protein (Active) (AB259425)
  • FuncS

Supplier Data

Functional Studies - Recombinant human PDGF B protein (Active) (AB259425)

Fully biologically active compared to a standard. The ED50 is is 0.9388 ng/mL corresponding to a Specific Activity of 1.07 x 106 IU/mg.

SDS-PAGE - Recombinant human PDGF B protein (Active) (AB259425)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human PDGF B protein (Active) (AB259425)

SDS-PAGE analysis of ab259425.

HPLC - Recombinant human PDGF B protein (Active) (AB259425)
  • HPLC

Supplier Data

HPLC - Recombinant human PDGF B protein (Active) (AB259425)

Purity 98%.

The spectrum was recorded using a 1260 Infinity II HPLC system with DAD and a MabPac RP column (3.0x100 mm, 4 μm). 5 μL of purified protein was injected and the gradient run from 80 % water : TFA (99.9 : 0.1 v/v) and 20 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) to 20 % water : TFA (99.9 : 0.1 v/v) and 80 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 3 min. Flow rate was 0.5 mL/min and the column compartment temperature was 50 °C.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

FuncS, SDS-PAGE, Mass Spec, Cell Culture, HPLC

applications

Biologically active

Yes

Biological activity

Fully biologically active compared to a standard. The ED50 is is 0.9388 ng/mL corresponding to a Specific Activity of 1.07 x 106 IU/mg.

Accession

P01127

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 6 - 8 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This protein is filter sterilised prior to aliquoting and lyophilisation. All aliquoting and lyophilisation steps are performed in a sterile environment

Sequence info

[{"sequence":"SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT","proteinLength":"Full Length","predictedMolecularWeight":"12.35 kDa","actualMolecularWeight":null,"aminoAcidEnd":190,"aminoAcidStart":82,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"P01127","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

PDGF-B also known as platelet-derived growth factor subunit B or PDGF-BB is a critical protein involved in various cellular processes. Composed of 241 amino acids PDGF-B exhibits a molecular mass of approximately 27 kDa. Scientists recognize this protein for its expression primarily in platelets but it also appears in a range of other tissues including smooth muscle cells and fibroblasts. The PDGF-B protein plays a substantial role in the regulation of growth and division inducing pathways important for cellular proliferation.
Biological function summary

PDGF-B influences cellular signaling processes and facilitates interactions that are a part of the PDGF receptor system. PDGF-B can form a homo-dimerization commonly known as the PDGF-BB dimer which is an active form. When PDGF-B binds to its receptor specifically the PDGF receptor β (PDGFR-β) it triggers pathways that control various cellular activities including growth and survival. The interaction of PDGF-B with the receptor is an important step that modulates several downstream signaling pathways.

Pathways

PDGF-B activates significant pathways such as the MAPK/ERK and PI3K/AKT pathways. These pathways play a major role in the regulation of cell proliferation and differentiation. Through these pathways PDGF-B exhibits interactions with proteins like Ras and Akt which are integral in transmitting signals within the cell. These cascades result in the promotion of processes such as angiogenesis and wound healing highlighting the importance of PDGF-B in cellular function.

Researchers have linked PDGF-B to pathologies such as cancer and atherosclerosis. For instance overexpression of PDGF-B can lead to abnormal vascular growth contributing to tumor development in cancers. It also plays a role in the progression of atherosclerosis by promoting the migration and proliferation of smooth muscle cells leading to plaque formation. In these contexts PDGF-B shows interaction with other proteins such as VEGF in tumor angiogenesis and LDL in atherosclerotic developments reinforcing its involvement in these conditions.

Specifications

Form

Lyophilized

Additional notes

Purity by HPLC >=95%.

General info

Function

Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin (PubMed : 26599395). Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA (By similarity).

Sequence similarities

Belongs to the PDGF/VEGF growth factor family.

Product protocols

Target data

Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin (PubMed : 26599395). Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA (By similarity).
See full target information PDGFB

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Arthritis research & therapy 25:194 PubMed37798786

2023

Preosteoclast plays a pathogenic role in syndesmophyte formation of ankylosing spondylitis through the secreted PDGFB - GRB2/ERK/RUNX2 pathway.

Applications

Unspecified application

Species

Unspecified reactive species

Yulong Tang,Kai Yang,Qingmei Liu,Yanyun Ma,Hao Zhu,Kunhai Tang,Chengchun Geng,Jiangnan Xie,Dachun Zhuo,Wenyu Wu,Li Jin,Wenze Xiao,Jiucun Wang,Qi Zhu,Jing Liu
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com