JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276237

Recombinant Human PDGFC protein (Fc Chimera)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human PDGFC protein (Fc Chimera) is a Human Fragment protein, in the 235 to 345 aa range, expressed in HEK 293 cells, with >97%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

SCDGF, UNQ174/PRO200, PDGFC, Platelet-derived growth factor C, PDGF-C, Fallotein, Spinal cord-derived growth factor, VEGF-E

1 Images
SDS-PAGE - Recombinant Human PDGFC protein (Fc Chimera) (AB276237)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human PDGFC protein (Fc Chimera) (AB276237)

SDS-PAGE analysis of ab276237

Key facts

Purity

>97% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

Fc tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q9NRA1

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.5 Constituents: 0.75% Glycine, 0.61% Tris, 0.06% Sodium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG","proteinLength":"Fragment","predictedMolecularWeight":"39 kDa","actualMolecularWeight":null,"aminoAcidEnd":345,"aminoAcidStart":235,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q9NRA1","tags":[{"tag":"Fc","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The protein PDGFC also called Platelet-Derived Growth Factor C functions mechanically as a growth factor involved in cell proliferation migration and survival. It belongs to the PDGF family and exhibits a molecular mass of approximately 38 kDa. PDGFC expresses in a variety of tissues such as the heart kidney and skeletal muscle. Unlike other PDGF family members PDGFC has a unique hinge region that requires proteolytic activation to reveal its growth factor activity.
Biological function summary

PDGFC supports angiogenesis and tissue remodeling which are essential for normal developmental processes and wound healing. It often forms part of a PDGF receptor-ligand complex by binding to the alpha and beta PDGF receptors. Upon binding PDGFC activates signaling pathways that result in cellular responses significant in tissues undergoing repair or in presence of injury.

Pathways

PDGFC plays a part in the MAPK and PI3K/AKT signaling pathways which regulate several cellular mechanisms. As it interacts with PDGF receptors PDGFC can collaborate with other proteins such as PDGFA and PDGFB both of which are significant for initiating similar pathways. These connections allow PDGFC to influence processes like cell cycle progression and apoptosis key elements in maintaining cellular homeostasis.

Alterations in PDGFC expression or signaling link to certain conditions such as cancer and fibrotic diseases. Overexpression of PDGFC relates to tumor growth and metastasis partially due to its role in angiogenesis where it can interact with proteins like VEGF. In fibrosis PDGFC acts by promoting excessive extracellular matrix production further involving it with proteins like transforming growth factor-beta (TGF-β) which contribute to tissue scarring and organ dysfunction.

Specifications

Form

Lyophilized

General info

Function

Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen and chemoattractant for cells of mesenchymal origin. Required for normal skeleton formation during embryonic development, especially for normal development of the craniofacial skeleton and for normal development of the palate. Required for normal skin morphogenesis during embryonic development. Plays an important role in wound healing, where it appears to be involved in three stages : inflammation, proliferation and remodeling. Plays an important role in angiogenesis and blood vessel development. Involved in fibrotic processes, in which transformation of interstitial fibroblasts into myofibroblasts plus collagen deposition occurs. The CUB domain has mitogenic activity in coronary artery smooth muscle cells, suggesting a role beyond the maintenance of the latency of the PDGF domain. In the nucleus, PDGFC seems to have additional function.

Sequence similarities

Belongs to the PDGF/VEGF growth factor family.

Post-translational modifications

Proteolytic removal of the N-terminal CUB domain releasing the core domain is necessary for unmasking the receptor-binding epitopes of the core domain. Cleavage after basic residues in the hinge region (region connecting the CUB and growth factor domains) gives rise to the receptor-binding form. Cleaved by PLAT and PLG.. Sumoylated with SUMO1.. N-glycosylated.

Subcellular localisation

Nucleus

Product protocols

Target data

Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen and chemoattractant for cells of mesenchymal origin. Required for normal skeleton formation during embryonic development, especially for normal development of the craniofacial skeleton and for normal development of the palate. Required for normal skin morphogenesis during embryonic development. Plays an important role in wound healing, where it appears to be involved in three stages : inflammation, proliferation and remodeling. Plays an important role in angiogenesis and blood vessel development. Involved in fibrotic processes, in which transformation of interstitial fibroblasts into myofibroblasts plus collagen deposition occurs. The CUB domain has mitogenic activity in coronary artery smooth muscle cells, suggesting a role beyond the maintenance of the latency of the PDGF domain. In the nucleus, PDGFC seems to have additional function.
See full target information PDGFC

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com