JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB236937

Recombinant Human Peroxiredoxin 2/PRP protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Peroxiredoxin 2/PRP protein (His tag) is a Human Full Length protein, in the 2 to 198 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

NKEFB, TDPX1, PRDX2, Peroxiredoxin-2, Natural killer cell-enhancing factor B, PRP, Thiol-specific antioxidant protein, Thioredoxin peroxidase 1, Thioredoxin-dependent peroxide reductase 1, Thioredoxin-dependent peroxiredoxin 2, NKEF-B, TSA

3 Images
Mass Spectrometry - Recombinant Human Peroxiredoxin 2/PRP protein (His tag) (AB236937)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human Peroxiredoxin 2/PRP protein (His tag) (AB236937)

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab236937 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) Peroxiredoxin 2/PRP.

Mass Spectrometry - Recombinant Human Peroxiredoxin 2/PRP protein (His tag) (AB236937)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human Peroxiredoxin 2/PRP protein (His tag) (AB236937)

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab236937 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) Peroxiredoxin 2/PRP.

SDS-PAGE - Recombinant Human Peroxiredoxin 2/PRP protein (His tag) (AB236937)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Peroxiredoxin 2/PRP protein (His tag) (AB236937)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab236937.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

P32119

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"ASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN","proteinLength":"Full Length","predictedMolecularWeight":"22 kDa","actualMolecularWeight":null,"aminoAcidEnd":198,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P32119","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Peroxiredoxin 2 (also known as PRP or PRDX2) is an antioxidant enzyme that plays an important role in reducing peroxides and protecting cells from oxidative damage. The target consisting of approximately 22kDa mass is expressed heavily in erythrocytes but can also be found in other tissues like the heart and liver. PRDX2 belongs to the peroxiredoxin family and its redox activity contributes significantly to cellular homeostasis and defense against oxidative stress.
Biological function summary

Peroxiredoxins like PRDX2 function by breaking down hydrogen peroxide and organic hydroperoxides safeguarding cells from oxidative harm. PRDX2 often forms homodimers or higher-order oligomers which influence its catalytic efficiency and chaperone activity. Within the cell it not only acts independently but also associates with other cellular components reflecting its participation in important cellular processes including cell proliferation and apoptosis.

Pathways

PRDX2 engages significantly within antioxidant defense systems specifically the thioredoxin pathway. It interacts with thioredoxin reductase and thioredoxin to facilitate the reduction of peroxides maintaining the cell’s redox balance. Furthermore PRDX2 intersects with cellular signaling pathways associated with inflammation and the regulation of cell death where proteins like NRF2 and KEAP1 play important roles in managing oxidant-inducible gene expression.

Disruptions in PRDX2 function connect to conditions like cancer and cardiovascular diseases. In cancer altered peroxiredoxin 2 expression correlates to tumor progression and resistance to chemotherapy implicating its interaction with proteins like NF-κB in enhancing cell survival. In cardiovascular diseases oxidative stress mediated by PRDX2 imbalance can lead to myocardial infarction and heart failure linking it to proteins such as SOD2 involved in mitochondrial defense.

Specifications

Form

Liquid

General info

Function

Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2).

Sequence similarities

Belongs to the peroxiredoxin family. AhpC/Prx1 subfamily.

Post-translational modifications

The enzyme can be inactivated by further oxidation of the cysteine sulfenic acid (C(P)-SOH) to sulphinic acid (C(P)-SO2H) instead of its condensation to a disulfide bond. It can be reactivated by forming a transient disulfide bond with sulfiredoxin SRXN1, which reduces the cysteine sulfinic acid in an ATP- and Mg-dependent manner.

Product protocols

Target data

Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2).
See full target information PRDX2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com