JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB9562

Recombinant human PF4 protein

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant human PF4 protein is a Human Full Length protein, in the 31 to 101 aa range, expressed in Escherichia coli, with >98%, suitable for SDS-PAGE, FuncS.

View Alternative Names

CXCL4, SCYB4, PF4, Platelet factor 4, PF-4, C-X-C motif chemokine 4, Iroplact, Oncostatin-A

Key facts

Purity

>98% SDS-PAGE

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Active

Accession

P02776

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute in 200ul sterile water to a conc. of 0.1 mg/ml.

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

The biological activity of this product is determined by its ability to chemoattract human fibroblasts using a concentration range of 1.0-10.0 ng/ml.

Sequence info

[{"sequence":"EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES","proteinLength":"Full Length","predictedMolecularWeight":"7.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":101,"aminoAcidStart":31,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P02776","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The protein Platelet Factor 4 (PF4) also known as CXCL4 is a member of the chemokine (C-X-C motif) ligand family. This small protein has a molecular weight of approximately 7.8 kDa. PF4 is mainly expressed in megakaryocytes and stored in the alpha granules of platelets. During platelet activation PF4 releases into the bloodstream where it interacts with other proteins and cell types. Researchers measure PF4 levels with methods such as PF4 ELISA to study its expression and functions under various physiological and pathological conditions.
Biological function summary

PF4 plays an important role in modulating the immune response and coagulation processes. PF4 is not part of a stable protein complex but can interact dynamically with heparin on the surface of endothelial cells and glycosaminoglycans. It inhibits the action of heparin promoting clot formation and angiogenesis. PF4 also attracts and activates different types of leukocytes and can regulate inflammatory processes influencing how the immune system responds to injury.

Pathways

PF4 significantly interacts with both the coagulation and inflammation pathways. In the coagulation pathway PF4 acts to neutralize heparin-like molecules thereby enhancing thrombosis. It works closely with proteins such as thrombin and fibrinogen contributing to the blood clot cascade. Within the inflammatory pathway PF4's chemokine activity helps direct leukocytes to sites of tissue damage or infection linking it to cytokines and other chemokines that mediate immune responses.

Researchers associate PF4 with conditions such as thrombosis and autoimmune pathologies. In thrombosis the overexpression of PF4 can lead to excessive clot formation pointing to its interaction with proteins like thrombin. PF4 also plays a role in heparin-induced thrombocytopenia (HIT) a disorder where the immune system mistakenly produces antibodies against heparin-PF4 complexes further indicating its direct involvement with immune and coagulation pathways.

Specifications

Form

Lyophilized

Additional notes

Endotoxin level is less than 0.1 ng per g (1EU/g).

General info

Function

Chemokine released during platelet aggregation that plays a role in different biological processes including hematopoiesis, cell proliferation, differentiation, and activation (PubMed : 29930254, PubMed : 9531587). Acts via different functional receptors including CCR1, CXCR3A or CXCR3B (PubMed : 18174362, PubMed : 29930254). Upon interaction with CXCR3A receptor, induces activated T-lymphocytes migration mediated via downstream Ras/extracellular signal-regulated kinase (ERK) signaling (PubMed : 18174362, PubMed : 24469069). Neutralizes the anticoagulant effect of heparin by binding more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Plays a role in the inhibition of hematopoiesis and in the maintenance of hematopoietic stem cell (HSC) quiescence (PubMed : 9531587). Chemotactic for neutrophils and monocytes via CCR1 (PubMed : 29930254). Inhibits endothelial cell proliferation. In cooperation with toll-like receptor 8/TLR8, induces chromatin remodeling and activates inflammatory gene expression via the TBK1-IRF5 axis (PubMed : 35701499). In addition, induces myofibroblast differentiation and collagen synthesis in different precursor cells, including endothelial cells, by stimulating endothelial-to-mesenchymal transition (PubMed : 34986347). Interacts with thrombomodulin/THBD to enhance the activation of protein C and thus potentiates its anticoagulant activity (PubMed : 9395524).

Sequence similarities

Belongs to the intercrine alpha (chemokine CxC) family.

Product protocols

Target data

Chemokine released during platelet aggregation that plays a role in different biological processes including hematopoiesis, cell proliferation, differentiation, and activation (PubMed : 29930254, PubMed : 9531587). Acts via different functional receptors including CCR1, CXCR3A or CXCR3B (PubMed : 18174362, PubMed : 29930254). Upon interaction with CXCR3A receptor, induces activated T-lymphocytes migration mediated via downstream Ras/extracellular signal-regulated kinase (ERK) signaling (PubMed : 18174362, PubMed : 24469069). Neutralizes the anticoagulant effect of heparin by binding more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Plays a role in the inhibition of hematopoiesis and in the maintenance of hematopoietic stem cell (HSC) quiescence (PubMed : 9531587). Chemotactic for neutrophils and monocytes via CCR1 (PubMed : 29930254). Inhibits endothelial cell proliferation. In cooperation with toll-like receptor 8/TLR8, induces chromatin remodeling and activates inflammatory gene expression via the TBK1-IRF5 axis (PubMed : 35701499). In addition, induces myofibroblast differentiation and collagen synthesis in different precursor cells, including endothelial cells, by stimulating endothelial-to-mesenchymal transition (PubMed : 34986347). Interacts with thrombomodulin/THBD to enhance the activation of protein C and thus potentiates its anticoagulant activity (PubMed : 9395524).
See full target information PF4

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Thrombosis research 208:129-137 PubMed34768097

2021

COVID-19 adenovirus vaccine triggers antibodies against PF4 complexes to activate complement and platelets.

Applications

Unspecified application

Species

Unspecified reactive species

Hanna H Pitkänen,Annukka Jouppila,Tuukka Helin,Vinaya Dulipati,Juha Kotimaa,Seppo Meri,Anu Kantele,Pinja Jalkanen,Ilkka Julkunen,Riitta Lassila
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com