JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB175469

Recombinant Human PGRPS protein - BSA and Azide free

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human PGRPS protein - BSA and Azide free is a Human Full Length protein, in the 22 to 196 aa range, expressed in Escherichia coli, with >90%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, ELISA, WB, Mass Spec.

View Alternative Names

PGLYRP, PGRP, TNFSF3L, SBBI68, UNQ639/PRO1269, PGLYRP1, Peptidoglycan recognition protein 1, Peptidoglycan recognition protein short, PGRP-S

1 Images
SDS-PAGE - Recombinant Human PGRPS protein - BSA and Azide free (AB175469)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human PGRPS protein - BSA and Azide free (AB175469)

14% SDS-PAGE analysis of ab175469

Lane 1 : reduced and heated sample (2.5 μg)

Lane 2 : Non-reduced and non-heated sample (2.5 μg)

Key facts

Purity

>90% Densitometry

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

WB, SDS-PAGE, Mass Spec, ELISA

applications

Biologically active

No

Accession

O75594

Animal free

No

Carrier free

Yes

Species

Human

Reconstitution

Reconstitute in 200 µL of 0.1 M acetate buffer, pH 4.0

Storage buffer

Constituents: 0.41% Sodium acetate

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"QETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP","proteinLength":"Full Length","predictedMolecularWeight":"20.68 kDa","actualMolecularWeight":null,"aminoAcidEnd":196,"aminoAcidStart":22,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O75594","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Peptidoglycan Recognition Proteins (PGRPs) are pattern recognition receptors known for their role in innate immunity. Some alternate names for PGRPs include PGLYRPs. These proteins identify bacterial peptidoglycans triggering immune responses. PGRPs have varying molecular masses that range typically between 20 to 25 kDa. Expression of PGRPs occurs in several tissues including skin eyes liver and throughout the gastrointestinal tract.
Biological function summary

Functioning in innate immunity PGRPs bind to bacterial cell wall components such as peptidoglycan and lipopolysaccharides. When PGRPs detect these molecules they can activate immune responses to neutralize pathogens. Some PGRPs can also act as amidases breaking down peptidoglycans. PGRPs do not usually act alone; they are part of complexes with other immune proteins to enhance pathogen recognition and response.

Pathways

PGRPs play significant roles in the immune pathway and inflammatory signaling pathways. They interact with the toll-like receptor pathways to mediate responses to bacterial infections. PGRPs also link with Nod proteins to modulate the immune response upon detecting peptidoglycans. These pathways help coordinate an effective defense against infection.

PGRPs’ malfunction or dysregulation links with inflammatory bowel disease and psoriasis. Altered PGRP levels correlate with changes in the gut flora contributing to inflammatory bowel disease. In psoriasis PGRPs’ improper function may exacerbate skin inflammation because they interact with proteins like IL-6 and TNF-alpha. Such interactions highlight their potential as therapeutic targets for these conditions.

Specifications

Form

Lyophilized

Additional notes

ab175469 was purifed using Ni-NTA chromatography.

General info

Function

Innate immunity protein that plays several important functions in antimicrobial and antitumor defense systems. Acts as a pattern receptor that binds to murein peptidoglycans (PGN) of Gram-positive bacteria and thus provides bactericidal activity (PubMed : 9707603). Forms an equimolar complex with heat shock protein HSPA1A and induces programmed cell death through apoptosis and necroptosis in tumor cell lines by activating the TNFR1 receptor on the target cell membrane (PubMed : 21247889, PubMed : 26183779). In addition, acts in complex with the Ca(2+)-binding protein S100A4 as a chemoattractant able to induce lymphocyte movement (PubMed : 26654597). Mechanistically, this complex acts as a ligand of the chemotactic receptors CCR5 and CXCR3 which are present on the cells of the immune system (PubMed : 30713770). Also promotes the activation of lymphocytes that become able to kill virus-infected cells as well as tumor cells by modulating the spectrum of their target-cell specificity (PubMed : 28977785, PubMed : 29083508). Induction of cytotoxicity on monocyte surface requires interaction with TREM1 receptor (PubMed : 25595774, PubMed : 28977785).

Sequence similarities

Belongs to the N-acetylmuramoyl-L-alanine amidase 2 family.

Post-translational modifications

N-glycosylated. N-glycosylation is required for bactericidal activity.

Product protocols

Target data

Innate immunity protein that plays several important functions in antimicrobial and antitumor defense systems. Acts as a pattern receptor that binds to murein peptidoglycans (PGN) of Gram-positive bacteria and thus provides bactericidal activity (PubMed : 9707603). Forms an equimolar complex with heat shock protein HSPA1A and induces programmed cell death through apoptosis and necroptosis in tumor cell lines by activating the TNFR1 receptor on the target cell membrane (PubMed : 21247889, PubMed : 26183779). In addition, acts in complex with the Ca(2+)-binding protein S100A4 as a chemoattractant able to induce lymphocyte movement (PubMed : 26654597). Mechanistically, this complex acts as a ligand of the chemotactic receptors CCR5 and CXCR3 which are present on the cells of the immune system (PubMed : 30713770). Also promotes the activation of lymphocytes that become able to kill virus-infected cells as well as tumor cells by modulating the spectrum of their target-cell specificity (PubMed : 28977785, PubMed : 29083508). Induction of cytotoxicity on monocyte surface requires interaction with TREM1 receptor (PubMed : 25595774, PubMed : 28977785).
See full target information PGLYRP1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com