JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB101155

Recombinant Human PHAP1 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human PHAP1 protein is a Human Full Length protein, in the 1 to 249 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

C15orf1, LANP, MAPM, PHAP1, ANP32A, Acidic leucine-rich nuclear phosphoprotein 32 family member A, Acidic nuclear phosphoprotein pp32, Leucine-rich acidic nuclear protein, Mapmodulin, Potent heat-stable protein phosphatase 2A inhibitor I1PP2A, Putative HLA-DR-associated protein I, pp32, PHAPI

1 Images
SDS-PAGE - Recombinant Human PHAP1 protein (AB101155)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human PHAP1 protein (AB101155)

15% SDS-PAGE (3 μg)

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

P39687

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.316% Tris HCl, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.00174% PMSF

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD","proteinLength":"Full Length","predictedMolecularWeight":"30.7 kDa","actualMolecularWeight":null,"aminoAcidEnd":249,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P39687","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

PHAP1 also known as putative HLA-associated protein 1 or ANP32A is a multifunctional phosphoprotein with a molecular weight of approximately 32 kDa. It exists within the nucleus and cytoplasm indicating its role in various cellular processes. PHAP1 expression is found across diverse tissues showing its widespread functional requirements in different biological contexts.
Biological function summary

PHAP1 plays an important role in regulating apoptosis and cell proliferation. It interacts with components of the INHAT complex which inhibits histone acetylation impacting chromatin remodeling and gene expression. By doing so it influences many cellular events such as cell cycle progression and differentiation. PHAP1's involvement in regulating cell death makes it a target for studying mechanisms underlying cell survival.

Pathways

PHAP1 is associated with apoptosis and cell signaling processes. It is intricately linked with the p38 MAPK signaling pathway important in stress response and inflammation. In these contexts PHAP1 interacts with proteins such as caspases and protein phosphatase 2A which are important for cellular responses to external and internal stimuli.

PHAP1 shows connections with cancer and neurodegenerative diseases. Altered expression levels of PHAP1 have been observed in certain types of cancers possibly affecting tumor growth and treatment responses. In neurodegeneration relations have been reported with tau proteins suggesting PHAP1's role in tauopathies potentially influencing disease progression and providing insights into therapeutic targets.

Specifications

Form

Liquid

Additional notes

ab101155 was purified using conventional chromatography techniques.

General info

Function

Multifunctional protein that is involved in the regulation of many processes including tumor suppression, apoptosis, cell cycle progression or transcription (PubMed : 10400610, PubMed : 11360199, PubMed : 16341127, PubMed : 18439902). Promotes apoptosis by favouring the activation of caspase-9/CASP9 and allowing apoptosome formation (PubMed : 18439902). In addition, plays a role in the modulation of histone acetylation and transcription as part of the INHAT (inhibitor of histone acetyltransferases) complex. Inhibits the histone-acetyltranferase activity of EP300/CREBBP (CREB-binding protein) and EP300/CREBBP-associated factor by histone masking (PubMed : 11830591). Preferentially binds to unmodified histone H3 and sterically inhibiting its acetylation and phosphorylation leading to cell growth inhibition (PubMed : 16341127). Participates in other biochemical processes such as regulation of mRNA nuclear-to-cytoplasmic translocation and stability by its association with ELAVL1 (Hu-antigen R) (PubMed : 18180367). Plays a role in E4F1-mediated transcriptional repression as well as inhibition of protein phosphatase 2A (PubMed : 15642345, PubMed : 17557114).. (Microbial infection) Plays an essential role in influenza A, B and C viral genome replication (PubMed : 30666459, PubMed : 32694517, PubMed : 33045004, PubMed : 33208942). Mechanistically, mediates the assembly of the viral replicase asymmetric dimers composed of PB1, PB2 and PA via its N-terminal region (PubMed : 33208942). Also plays an essential role in foamy virus mRNA export from the nucleus (PubMed : 21159877).

Sequence similarities

Belongs to the ANP32 family.

Post-translational modifications

Phosphorylated on serine residues, at least in part by casein kinase 2/CK2.. The N-terminus is blocked.. Some glutamate residues are glycylated by TTLL8. This modification occurs exclusively on glutamate residues and results in a glycine chain on the gamma-carboxyl group (By similarity).

Subcellular localisation

Nucleus

Product protocols

Target data

Multifunctional protein that is involved in the regulation of many processes including tumor suppression, apoptosis, cell cycle progression or transcription (PubMed : 10400610, PubMed : 11360199, PubMed : 16341127, PubMed : 18439902). Promotes apoptosis by favouring the activation of caspase-9/CASP9 and allowing apoptosome formation (PubMed : 18439902). In addition, plays a role in the modulation of histone acetylation and transcription as part of the INHAT (inhibitor of histone acetyltransferases) complex. Inhibits the histone-acetyltranferase activity of EP300/CREBBP (CREB-binding protein) and EP300/CREBBP-associated factor by histone masking (PubMed : 11830591). Preferentially binds to unmodified histone H3 and sterically inhibiting its acetylation and phosphorylation leading to cell growth inhibition (PubMed : 16341127). Participates in other biochemical processes such as regulation of mRNA nuclear-to-cytoplasmic translocation and stability by its association with ELAVL1 (Hu-antigen R) (PubMed : 18180367). Plays a role in E4F1-mediated transcriptional repression as well as inhibition of protein phosphatase 2A (PubMed : 15642345, PubMed : 17557114).. (Microbial infection) Plays an essential role in influenza A, B and C viral genome replication (PubMed : 30666459, PubMed : 32694517, PubMed : 33045004, PubMed : 33208942). Mechanistically, mediates the assembly of the viral replicase asymmetric dimers composed of PB1, PB2 and PA via its N-terminal region (PubMed : 33208942). Also plays an essential role in foamy virus mRNA export from the nucleus (PubMed : 21159877).
See full target information ANP32A

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com