JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB164670

Recombinant Human PHF5A protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human PHF5A protein is a Human Full Length protein, in the 1 to 110 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

PHD finger-like domain-containing protein 5A, PHD finger-like domain protein 5A, Splicing factor 3B-associated 14 kDa protein, SF3b14b, PHF5A

1 Images
SDS-PAGE - Recombinant Human PHF5A protein (AB164670)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human PHF5A protein (AB164670)

ab164670 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

Q7RTV0

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":110,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q7RTV0","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

PHF5A also called PHD finger protein 5A is a part of the spliceosome complex. This protein weighs around 13 kDa and is involved in regulating RNA splicing. PHF5A is mainly expressed in the cell nucleus where it plays a role in the splicing machinery. The protein interacts with components of the spliceosome facilitating assembly and function which are necessary for proper RNA splicing events.
Biological function summary

PHF5A functions as an important component of the splicing factor complex. It supports the recognition and selection of splice sites during pre-mRNA processing. PHF5A forms part of the U2 small nuclear ribonucleoprotein complex which is involved in the splicing of pre-messenger RNA. This complex interaction suggests its role in the accurate modification of pre-mRNA into a mature mRNA an important process in gene expression regulation.

Pathways

PHF5A takes part in the RNA splicing pathway. This pathway contains critical interactions that contribute to the mRNA processing necessary for gene expression. PHF5A is related to other spliceosome components such as SF3b which work together in the splicing process. Through these interactions PHF5A supports gene expression regulation which is important for cellular function and homeostasis.

PHF5A is associated with cancer particularly glioblastoma. The protein's role in RNA splicing links it to the misregulation observed in these cancers. PHF5A interacts with splicing factors whose altered expression or function can contribute to tumorigenesis. Disruptions in its pathway might affect the expression of genes involved in cell cycle regulation playing a significant role in disease progression.

Specifications

Form

Liquid

General info

Function

Component of the 17S U2 SnRNP complex of the spliceosome, a large ribonucleoprotein complex that removes introns from transcribed pre-mRNAs (PubMed : 12234937, PubMed : 27720643, PubMed : 28541300, PubMed : 32494006, PubMed : 34822310). The 17S U2 SnRNP complex (1) directly participates in early spliceosome assembly and (2) mediates recognition of the intron branch site during pre-mRNA splicing by promoting the selection of the pre-mRNA branch-site adenosine, the nucleophile for the first step of splicing (PubMed : 12234937, PubMed : 32494006, PubMed : 34822310). Within the 17S U2 SnRNP complex, PHF5A is part of the SF3B subcomplex, which is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence in pre-mRNA (PubMed : 12234937, PubMed : 27720643). Sequence independent binding of SF3A and SF3B subcomplexes upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA (PubMed : 12234937). Also acts as a component of the minor spliceosome, which is involved in the splicing of U12-type introns in pre-mRNAs (PubMed : 15146077, PubMed : 33509932). Also involved in elongation by RNA polymerase II as part of the PAF1 complex (PAF1C) (By similarity). PAF1C is required for maintenance of embryonic stem cell (ESC) self-renewal and cellular reprogramming of stem cells (By similarity). Maintains pluripotency by recruiting and stabilizing PAF1C on pluripotency genes loci, and by regulating the expression of the pluripotency genes (By similarity). Regulates the deposition of elongation-associated histone modifications, including dimethylated histone H3 'Lys-79' (H3K79me2) and trimethylated histone H3 'Lys-36' (H3K36me3), on PAF1C targets, self-renewal and pluripotency genes (By similarity). Regulates RNA polymerase II promoter-proximal pause release of the PAF1C targets and self-renewal genes, and the levels of elongating ('Ser-2' phosphorylated) RNA polymerase II in their gene bodies (By similarity). Regulates muscle specification in adult stem cells by stabilizing PAF1C in chromatin to promote myogenic differentiation (By similarity). Acts as a transcriptional regulator by binding to the GJA1/Cx43 promoter and enhancing its up-regulation by ESR1/ER-alpha (By similarity).

Sequence similarities

Belongs to the PHF5 family.

Subcellular localisation

Nucleus

Product protocols

Target data

Component of the 17S U2 SnRNP complex of the spliceosome, a large ribonucleoprotein complex that removes introns from transcribed pre-mRNAs (PubMed : 12234937, PubMed : 27720643, PubMed : 28541300, PubMed : 32494006, PubMed : 34822310). The 17S U2 SnRNP complex (1) directly participates in early spliceosome assembly and (2) mediates recognition of the intron branch site during pre-mRNA splicing by promoting the selection of the pre-mRNA branch-site adenosine, the nucleophile for the first step of splicing (PubMed : 12234937, PubMed : 32494006, PubMed : 34822310). Within the 17S U2 SnRNP complex, PHF5A is part of the SF3B subcomplex, which is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence in pre-mRNA (PubMed : 12234937, PubMed : 27720643). Sequence independent binding of SF3A and SF3B subcomplexes upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA (PubMed : 12234937). Also acts as a component of the minor spliceosome, which is involved in the splicing of U12-type introns in pre-mRNAs (PubMed : 15146077, PubMed : 33509932). Also involved in elongation by RNA polymerase II as part of the PAF1 complex (PAF1C) (By similarity). PAF1C is required for maintenance of embryonic stem cell (ESC) self-renewal and cellular reprogramming of stem cells (By similarity). Maintains pluripotency by recruiting and stabilizing PAF1C on pluripotency genes loci, and by regulating the expression of the pluripotency genes (By similarity). Regulates the deposition of elongation-associated histone modifications, including dimethylated histone H3 'Lys-79' (H3K79me2) and trimethylated histone H3 'Lys-36' (H3K36me3), on PAF1C targets, self-renewal and pluripotency genes (By similarity). Regulates RNA polymerase II promoter-proximal pause release of the PAF1C targets and self-renewal genes, and the levels of elongating ('Ser-2' phosphorylated) RNA polymerase II in their gene bodies (By similarity). Regulates muscle specification in adult stem cells by stabilizing PAF1C in chromatin to promote myogenic differentiation (By similarity). Acts as a transcriptional regulator by binding to the GJA1/Cx43 promoter and enhancing its up-regulation by ESR1/ER-alpha (By similarity).
See full target information PHF5A

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com