JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB63843

Recombinant Human phospholipase A2 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human phospholipase A2 protein is a Human Full Length protein, in the 21 to 144 aa range, expressed in Escherichia coli, with >95%, suitable for WB.

View Alternative Names

PLA2B, PLA2L, RASF-A, PLA2G2A, GIIC sPLA2, Group IIA phospholipase A2, Non-pancreatic secretory phospholipase A2, Phosphatidylcholine 2-acylhydrolase 2A, NPS-PLA2

1 Images
SDS-PAGE - Recombinant Human phospholipase A2 protein (AB63843)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human phospholipase A2 protein (AB63843)

12% SDS-PAGE separation of ab63843. Molecular Weight : ~15.8 kDa.

Lane 1. Molecular weight marker
Lane 2. reduced and heated sample, 10μg/lane
Lane 3. non-reduced and non-heated sample, 10μg/lane

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

WB

applications

Biologically active

No

Accession

P14555

Animal free

No

Carrier free

Yes

Species

Human

Reconstitution

Reconstitute at 0.5 mg/mL in 0.1 M acetate buffer, pH 4.0

Storage buffer

Constituents: 0.41% Sodium acetate

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Product is NOT sterile! Please filter the product by an appropriate sterile filter before using it in cell culture.

Sequence info

[{"sequence":"MRGSHHHHHHGMASHMNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRC","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":144,"aminoAcidStart":21,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P14555","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Phospholipase A2 (PLA2) is an enzyme that hydrolyzes the sn-2 ester bond of phospholipids releasing fatty acids and lysophospholipids. This process is essential for producing pro-inflammatory eicosanoids and other lipid mediators. Commonly known as PLA2 or phospholipase its molecular mass varies depending on its type ranging from 14 to 45 kDa. PLA2 is expressed in many tissues including the pancreas brain and immune cells highlighting its diverse role in different physiological contexts.
Biological function summary

Phospholipase A2 contributes to membrane remodeling and the release of arachidonic acid a precursor to prostaglandins and leukotrienes vital for inflammatory responses. It often functions as part of a complex with other proteins that regulate its activity ensuring precise lipid signaling and homeostasis. Understanding PLA2 function leads to insights into cell signaling and inflammatory regulation.

Pathways

Phospholipase A2 plays a significant role in the arachidonic acid pathway and is involved in the production of eicosanoids. These pathways are important for the inflammatory response and involve interactions with cyclooxygenases (COX) and lipoxygenases (LOX). Through these pathways PLA2 activity can influence immune responses and cellular metabolism making it an important component in inflammatory signaling cascades.

Phospholipase A2 is implicated in conditions like arthritis and atherosclerosis. Its role in inflammation makes it a potential target for therapeutic interventions. PLA2 interacts with proteins such as COX-2 which are involved in the inflammatory response in arthritis while its role in lipid metabolism links it to the formation of atherosclerotic plaques. Understanding these connections can aid in developing treatments for inflammatory and cardiovascular diseases.

Specifications

Form

Lyophilized

General info

Function

Secretory calcium-dependent phospholipase A2 that primarily targets extracellular phospholipids with implications in host antimicrobial defense, inflammatory response and tissue regeneration (PubMed : 10455175, PubMed : 10681567, PubMed : 2925633). Hydrolyzes the ester bond of the fatty acyl group attached at sn-2 position of phospholipids (phospholipase A2 activity) with preference for phosphatidylethanolamines and phosphatidylglycerols over phosphatidylcholines (PubMed : 10455175, PubMed : 10681567). Contributes to lipid remodeling of cellular membranes and generation of lipid mediators involved in pathogen clearance. Displays bactericidal activity against Gram-positive bacteria by directly hydrolyzing phospholipids of the bacterial membrane (PubMed : 10358193, PubMed : 11694541). Upon sterile inflammation, targets membrane phospholipids of extracellular mitochondria released from activated platelets, generating free unsaturated fatty acids such as arachidonate that is used by neighboring leukocytes to synthesize inflammatory eicosanoids such as leukotrienes. Simultaneously, by compromising mitochondrial membrane integrity, promotes the release in circulation of potent damage-associated molecular pattern molecules that activate the innate immune response (PubMed : 25082876). Plays a stem cell regulator role in the intestinal crypt. Within intracellular compartment mediates Paneth cell differentiation and its stem cell supporting functions by inhibiting Wnt signaling pathway in intestinal stem cell (ICS). Secreted in the intestinal lumen upon inflammation, acts in an autocrine way and promotes prostaglandin E2 synthesis that stimulates Wnt signaling pathway in ICS cells and tissue regeneration (By similarity). May play a role in the biosynthesis of N-acyl ethanolamines that regulate energy metabolism and inflammation. Hydrolyzes N-acyl phosphatidylethanolamines to N-acyl lysophosphatidylethanolamines, which are further cleaved by a lysophospholipase D to release N-acyl ethanolamines (PubMed : 14998370). Independent of its catalytic activity, acts as a ligand for integrins (PubMed : 18635536, PubMed : 25398877). Binds to and activates integrins ITGAV : ITGB3, ITGA4 : ITGB1 and ITGA5 : ITGB1 (PubMed : 18635536, PubMed : 25398877). Binds to a site (site 2) which is distinct from the classical ligand-binding site (site 1) and induces integrin conformational changes and enhanced ligand binding to site 1 (PubMed : 25398877). Induces cell proliferation in an integrin-dependent manner (PubMed : 18635536).

Sequence similarities

Belongs to the phospholipase A2 family.

Subcellular localisation

Mitochondrion outer membrane

Product protocols

Target data

Secretory calcium-dependent phospholipase A2 that primarily targets extracellular phospholipids with implications in host antimicrobial defense, inflammatory response and tissue regeneration (PubMed : 10455175, PubMed : 10681567, PubMed : 2925633). Hydrolyzes the ester bond of the fatty acyl group attached at sn-2 position of phospholipids (phospholipase A2 activity) with preference for phosphatidylethanolamines and phosphatidylglycerols over phosphatidylcholines (PubMed : 10455175, PubMed : 10681567). Contributes to lipid remodeling of cellular membranes and generation of lipid mediators involved in pathogen clearance. Displays bactericidal activity against Gram-positive bacteria by directly hydrolyzing phospholipids of the bacterial membrane (PubMed : 10358193, PubMed : 11694541). Upon sterile inflammation, targets membrane phospholipids of extracellular mitochondria released from activated platelets, generating free unsaturated fatty acids such as arachidonate that is used by neighboring leukocytes to synthesize inflammatory eicosanoids such as leukotrienes. Simultaneously, by compromising mitochondrial membrane integrity, promotes the release in circulation of potent damage-associated molecular pattern molecules that activate the innate immune response (PubMed : 25082876). Plays a stem cell regulator role in the intestinal crypt. Within intracellular compartment mediates Paneth cell differentiation and its stem cell supporting functions by inhibiting Wnt signaling pathway in intestinal stem cell (ICS). Secreted in the intestinal lumen upon inflammation, acts in an autocrine way and promotes prostaglandin E2 synthesis that stimulates Wnt signaling pathway in ICS cells and tissue regeneration (By similarity). May play a role in the biosynthesis of N-acyl ethanolamines that regulate energy metabolism and inflammation. Hydrolyzes N-acyl phosphatidylethanolamines to N-acyl lysophosphatidylethanolamines, which are further cleaved by a lysophospholipase D to release N-acyl ethanolamines (PubMed : 14998370). Independent of its catalytic activity, acts as a ligand for integrins (PubMed : 18635536, PubMed : 25398877). Binds to and activates integrins ITGAV : ITGB3, ITGA4 : ITGB1 and ITGA5 : ITGB1 (PubMed : 18635536, PubMed : 25398877). Binds to a site (site 2) which is distinct from the classical ligand-binding site (site 1) and induces integrin conformational changes and enhanced ligand binding to site 1 (PubMed : 25398877). Induces cell proliferation in an integrin-dependent manner (PubMed : 18635536).
See full target information PLA2G2A

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com