JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB112339

Recombinant Human Phospholipase C gamma 1/PLC-gamma-1 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Phospholipase C gamma 1/PLC-gamma-1 protein is a Human Fragment protein, in the 1192 to 1291 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

PLC1, PLCG1, PLC-148, Phosphoinositide phospholipase C-gamma-1, Phospholipase C-II, Phospholipase C-gamma-1, PLC-II, PLC-gamma-1

1 Images
SDS-PAGE - Recombinant Human Phospholipase C gamma 1/PLC-gamma-1 protein (AB112339)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Phospholipase C gamma 1/PLC-gamma-1 protein (AB112339)

ab112339 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, SDS-PAGE, WB

applications

Biologically active

No

Accession

P19174

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Sequence info

[{"sequence":"LKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL","proteinLength":"Fragment","predictedMolecularWeight":"36.63 kDa","actualMolecularWeight":null,"aminoAcidEnd":1291,"aminoAcidStart":1192,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P19174","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Phospholipase C gamma 1 (PLC-gamma-1) also known as PLCG1 or PLC-gamma plays an important role in cellular signaling. This enzyme has a molecular mass of approximately 150 kDa. It is found in multiple cell types but is highly expressed in the brain and immune cells. PLC-gamma-1 is involved in the hydrolysis of phosphatidylinositol 45-bisphosphate (PIP2) to generate inositol 145-trisphosphate (IP3) and diacylglycerol (DAG) leading to downstream signaling events that control various cellular processes.
Biological function summary

PLC-gamma-1 is integral in signal transduction and is an important player in the immune response. The protein does not function as part of a large multi-protein complex but interacts transiently with other signaling molecules. It acts downstream of growth factor receptors and immunoreceptors by mediating calcium release and activation of protein kinase C influencing cell proliferation migration and differentiation. Its expression pattern suggests a critical role in the nervous and immune systems affecting learning memory and immune defense.

Pathways

PLC-gamma-1 is an important component in both the phospholipase C and PLC-gamma pathways. These pathways include important interactions with proteins such as the receptor tyrosine kinases and Src family kinases. In these pathways PLC-gamma-1 modulates signals that guide cellular responses to external stimuli affecting processes like growth signaling and T-cell receptor activation which is vital in adaptive immunity.

PLC-gamma-1 has significant connections to cancer and immune deficiencies. Abnormal PLC-gamma-1 activity is observed in certain cancers such as breast cancer where it influences tumor growth and metastasis. Its dysregulation in immune cells leads to disorders like autoimmune diseases by impacting proteins such as LAT and SLP-76 which are important in T-cell signaling. Understanding PLC-gamma-1’s regulatory mechanisms helps in developing targeted therapies for these conditions.

Specifications

Form

Liquid

General info

Function

Mediates the production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). Plays an important role in the regulation of intracellular signaling cascades. Becomes activated in response to ligand-mediated activation of receptor-type tyrosine kinases, such as PDGFRA, PDGFRB, EGFR, FGFR1, FGFR2, FGFR3 and FGFR4 (By similarity). Plays a role in actin reorganization and cell migration (PubMed : 17229814). Guanine nucleotide exchange factor that binds the GTPase DNM1 and catalyzes the dissociation of GDP, allowing a GTP molecule to bind in its place, therefore enhancing DNM1-dependent endocytosis (By similarity).

Post-translational modifications

Tyrosine phosphorylated in response to signaling via activated FLT3, KIT and PDGFRA (By similarity). Tyrosine phosphorylated by activated FGFR1, FGFR2, FGFR3 and FGFR4. Tyrosine phosphorylated by activated FLT1 and KDR. Tyrosine phosphorylated by activated PDGFRB. The receptor-mediated activation of PLCG1 involves its phosphorylation by tyrosine kinases, in response to ligation of a variety of growth factor receptors and immune system receptors. For instance, SYK phosphorylates and activates PLCG1 in response to ligation of the B-cell receptor. May be dephosphorylated by PTPRJ. Phosphorylated by ITK and TXK on Tyr-783 upon TCR activation in T-cells.. Ubiquitinated by CBLB in activated T-cells.

Product protocols

Target data

Mediates the production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). Plays an important role in the regulation of intracellular signaling cascades. Becomes activated in response to ligand-mediated activation of receptor-type tyrosine kinases, such as PDGFRA, PDGFRB, EGFR, FGFR1, FGFR2, FGFR3 and FGFR4 (By similarity). Plays a role in actin reorganization and cell migration (PubMed : 17229814). Guanine nucleotide exchange factor that binds the GTPase DNM1 and catalyzes the dissociation of GDP, allowing a GTP molecule to bind in its place, therefore enhancing DNM1-dependent endocytosis (By similarity).
See full target information PLCG1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com