JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB159127

Recombinant Human PI 3 Kinase catalytic subunit alpha/PIK3CA protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human PI 3 Kinase catalytic subunit alpha/PIK3CA protein is a Human Fragment protein, in the 959 to 1068 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

PI3-kinase subunit alpha, PI3K-alpha, PI3Kalpha, PtdIns-3-kinase subunit alpha, Phosphoinositide 3-kinase alpha, Phosphoinositide-3-kinase catalytic alpha polypeptide, Serine/threonine protein kinase PIK3CA, PtdIns-3-kinase subunit p110-alpha, p110alpha, PIK3CA

1 Images
SDS-PAGE - Recombinant Human PI 3 Kinase catalytic subunit alpha/PIK3CA protein (AB159127)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human PI 3 Kinase catalytic subunit alpha/PIK3CA protein (AB159127)

ab159127 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

P42336

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"DFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":1068,"aminoAcidStart":959,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P42336","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

PI 3 kinase catalytic subunit alpha also known as PIK3CA or PI3K-alpha is a protein kinase with significant roles in cellular signaling. This protein has a mass of approximately 124 kDa and is part of the PI3 kinase family. PIK3CA is primarily expressed in various tissues including the liver breast and pancreas where it plays an important role in the regulation of cell growth and survival. The structure of PI3 kinase involves a complex of p110 catalytic subunits and p85 regulatory subunits which facilitate its enzymatic functions.
Biological function summary

The PIK3CA protein phosphorylates the inositol ring of phosphoinositides generating phosphatidylinositol (345)-trisphosphate (PIP3) a lipid second messenger involved in numerous signaling pathways. PIK3CA often acts within a complex interacting with regulatory subunits such as p85 to control its activity. The complex formation enhances its stability and localization to the cell membrane where it can exert its enzymatic actions effectively. In its biological capacity PIK3CA plays a role in cellular proliferation survival and metabolism.

Pathways

The PI3K/Akt signaling pathway involves PIK3CA as an important mediator. This pathway is integral to numerous cellular processes including metabolism growth and survival. PIK3CA links closely with Akt a downstream protein kinase that propagates the signal initiated by PIP3 generation. The mTOR pathway is another critical route involving PIK3CA where it regulates translation and cellular growth. These pathways emphasize the importance of PIK3CA in maintaining cellular homeostasis and responding to external growth signals.

Mutations and aberrations in PIK3CA associate with several cancers especially breast and colorectal cancers. The altered activity of PIK3CA can cause uncontrolled cell proliferation due to constant activation of the PI3K/Akt signaling pathway. This disrupts normal cellular apoptosis and fosters tumor growth. Additionally PIK3CA mutations are linked to certain genetic disorders such as PIK3CA-related overgrowth spectrum (PROS) where overactivation alters normal tissue growth and development. The interaction of PIK3CA with proteins like PTEN a tumor suppressor involved in cancer pathways also highlights its significance in oncogenic processes.

Specifications

Form

Liquid

General info

Function

Phosphoinositide-3-kinase (PI3K) phosphorylates phosphatidylinositol (PI) and its phosphorylated derivatives at position 3 of the inositol ring to produce 3-phosphoinositides (PubMed : 15135396, PubMed : 23936502, PubMed : 28676499). Uses ATP and PtdIns(4,5)P2 (phosphatidylinositol 4,5-bisphosphate) to generate phosphatidylinositol 3,4,5-trisphosphate (PIP3) (PubMed : 15135396, PubMed : 28676499). PIP3 plays a key role by recruiting PH domain-containing proteins to the membrane, including AKT1 and PDPK1, activating signaling cascades involved in cell growth, survival, proliferation, motility and morphology. Participates in cellular signaling in response to various growth factors. Involved in the activation of AKT1 upon stimulation by receptor tyrosine kinases ligands such as EGF, insulin, IGF1, VEGFA and PDGF. Involved in signaling via insulin-receptor substrate (IRS) proteins. Essential in endothelial cell migration during vascular development through VEGFA signaling, possibly by regulating RhoA activity. Required for lymphatic vasculature development, possibly by binding to RAS and by activation by EGF and FGF2, but not by PDGF. Regulates invadopodia formation through the PDPK1-AKT1 pathway. Participates in cardiomyogenesis in embryonic stem cells through a AKT1 pathway. Participates in vasculogenesis in embryonic stem cells through PDK1 and protein kinase C pathway. In addition to its lipid kinase activity, it displays a serine-protein kinase activity that results in the autophosphorylation of the p85alpha regulatory subunit as well as phosphorylation of other proteins such as 4EBP1, H-Ras, the IL-3 beta c receptor and possibly others (PubMed : 23936502, PubMed : 28676499). Plays a role in the positive regulation of phagocytosis and pinocytosis (By similarity).

Sequence similarities

Belongs to the PI3/PI4-kinase family.

Product protocols

Target data

Phosphoinositide-3-kinase (PI3K) phosphorylates phosphatidylinositol (PI) and its phosphorylated derivatives at position 3 of the inositol ring to produce 3-phosphoinositides (PubMed : 15135396, PubMed : 23936502, PubMed : 28676499). Uses ATP and PtdIns(4,5)P2 (phosphatidylinositol 4,5-bisphosphate) to generate phosphatidylinositol 3,4,5-trisphosphate (PIP3) (PubMed : 15135396, PubMed : 28676499). PIP3 plays a key role by recruiting PH domain-containing proteins to the membrane, including AKT1 and PDPK1, activating signaling cascades involved in cell growth, survival, proliferation, motility and morphology. Participates in cellular signaling in response to various growth factors. Involved in the activation of AKT1 upon stimulation by receptor tyrosine kinases ligands such as EGF, insulin, IGF1, VEGFA and PDGF. Involved in signaling via insulin-receptor substrate (IRS) proteins. Essential in endothelial cell migration during vascular development through VEGFA signaling, possibly by regulating RhoA activity. Required for lymphatic vasculature development, possibly by binding to RAS and by activation by EGF and FGF2, but not by PDGF. Regulates invadopodia formation through the PDPK1-AKT1 pathway. Participates in cardiomyogenesis in embryonic stem cells through a AKT1 pathway. Participates in vasculogenesis in embryonic stem cells through PDK1 and protein kinase C pathway. In addition to its lipid kinase activity, it displays a serine-protein kinase activity that results in the autophosphorylation of the p85alpha regulatory subunit as well as phosphorylation of other proteins such as 4EBP1, H-Ras, the IL-3 beta c receptor and possibly others (PubMed : 23936502, PubMed : 28676499). Plays a role in the positive regulation of phagocytosis and pinocytosis (By similarity).
See full target information PIK3CA

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com