JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB159128

Recombinant Human PI3 Kinase p110 beta protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human PI3 Kinase p110 beta protein (GST tag N-Terminus) is a Human Fragment protein, in the 147 to 256 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

PIK3C1, PIK3CB, PI3-kinase subunit beta, PI3K-beta, PI3Kbeta, PtdIns-3-kinase subunit beta, Serine/threonine protein kinase PIK3CB, PtdIns-3-kinase subunit p110-beta, p110beta

1 Images
SDS-PAGE - Recombinant Human PI3 Kinase p110 beta protein (GST tag N-Terminus) (AB159128)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human PI3 Kinase p110 beta protein (GST tag N-Terminus) (AB159128)

ab159128 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

P42338

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"EFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPYDYVLQVSGRVEY","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":256,"aminoAcidStart":147,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P42338","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Phosphatidylinositol 3-kinase p110 beta (PI3 kinase p110β) also known as PI3Kβ is an enzyme that belongs to the class I PI3-kinases. It functions as a catalytic subunit in the PI3K complex. The PI3 kinase p110β has a molecular mass of approximately 122 kDa. This protein is expressed in various tissues with notable presence in heart and skeletal muscles. The enzyme is responsible for phosphorylating PIP2 to generate PIP3 an essential step in signaling pathways that regulate cell growth and survival.
Biological function summary

PI3 kinase p110β plays a role in the regulation of cellular processes such as proliferation migration and metabolism. It is a component of the PI3K complex comprised of regulatory and catalytic subunits which form functional homodimers or heterodimers. This complex is activated by various receptors including G-protein coupled receptors (GPCRs) and tyrosine kinase receptors. By converting PIP2 to PIP3 it aids in the recruitment and activation of downstream signaling proteins like AKT.

Pathways

PI3 kinase p110β is integral in the PI3K/AKT signaling pathway and also contributes to the regulation of the mTOR pathway. These pathways are critical for controlling cellular responses to growth signals and maintaining homeostasis. Association with proteins like PTEN which negatively regulates the PI3K/AKT pathway highlights its importance in maintaining cellular balance. PI3 kinase p110β also interacts with other PI3 proteins like p110α showing the intricate network of signaling it participates in.

PI3 kinase p110β has been implicated in cancer and cardiovascular diseases. Its overactivation leads to unchecked cellular proliferation contributing significantly to oncogenesis. Alterations in the PI3K/AKT/mTOR pathway are common in breast cancer highlighting its interaction with proteins such as ERBB2. In cardiovascular disorders PI3 kinase p110β influences heart development and function where it can impact the action of related proteins like PI3 kinase p110α. The study of PI3 kinase p110β in these diseases offers potential for targeted therapies and improved understanding of its pathological roles.

Specifications

Form

Liquid

General info

Function

Phosphoinositide-3-kinase (PI3K) phosphorylates phosphatidylinositol derivatives at position 3 of the inositol ring to produce 3-phosphoinositides (PubMed : 15135396). Uses ATP and PtdIns(4,5)P2 (phosphatidylinositol 4,5-bisphosphate) to generate phosphatidylinositol 3,4,5-trisphosphate (PIP3) (PubMed : 15135396). PIP3 plays a key role by recruiting PH domain-containing proteins to the membrane, including AKT1 and PDPK1, activating signaling cascades involved in cell growth, survival, proliferation, motility and morphology. Involved in the activation of AKT1 upon stimulation by G-protein coupled receptors (GPCRs) ligands such as CXCL12, sphingosine 1-phosphate, and lysophosphatidic acid. May also act downstream receptor tyrosine kinases. Required in different signaling pathways for stable platelet adhesion and aggregation. Plays a role in platelet activation signaling triggered by GPCRs, alpha-IIb/beta-3 integrins (ITGA2B/ ITGB3) and ITAM (immunoreceptor tyrosine-based activation motif)-bearing receptors such as GP6. Regulates the strength of adhesion of ITGA2B/ ITGB3 activated receptors necessary for the cellular transmission of contractile forces. Required for platelet aggregation induced by F2 (thrombin) and thromboxane A2 (TXA2). Has a role in cell survival. May have a role in cell migration. Involved in the early stage of autophagosome formation. Modulates the intracellular level of PtdIns3P (phosphatidylinositol 3-phosphate) and activates PIK3C3 kinase activity. May act as a scaffold, independently of its lipid kinase activity to positively regulate autophagy. May have a role in insulin signaling as scaffolding protein in which the lipid kinase activity is not required. May have a kinase-independent function in regulating cell proliferation and in clathrin-mediated endocytosis. Mediator of oncogenic signal in cell lines lacking PTEN. The lipid kinase activity is necessary for its role in oncogenic transformation. Required for the growth of ERBB2 and RAS driven tumors. Has also a protein kinase activity showing autophosphorylation (PubMed : 12502714).

Sequence similarities

Belongs to the PI3/PI4-kinase family.

Post-translational modifications

Autophosphorylation at Ser-1070 negatively regulates the phosphatidylinositol-4,5-bisphosphate 3-kinase activity.

Subcellular localisation

Nucleus

Product protocols

Target data

Phosphoinositide-3-kinase (PI3K) phosphorylates phosphatidylinositol derivatives at position 3 of the inositol ring to produce 3-phosphoinositides (PubMed : 15135396). Uses ATP and PtdIns(4,5)P2 (phosphatidylinositol 4,5-bisphosphate) to generate phosphatidylinositol 3,4,5-trisphosphate (PIP3) (PubMed : 15135396). PIP3 plays a key role by recruiting PH domain-containing proteins to the membrane, including AKT1 and PDPK1, activating signaling cascades involved in cell growth, survival, proliferation, motility and morphology. Involved in the activation of AKT1 upon stimulation by G-protein coupled receptors (GPCRs) ligands such as CXCL12, sphingosine 1-phosphate, and lysophosphatidic acid. May also act downstream receptor tyrosine kinases. Required in different signaling pathways for stable platelet adhesion and aggregation. Plays a role in platelet activation signaling triggered by GPCRs, alpha-IIb/beta-3 integrins (ITGA2B/ ITGB3) and ITAM (immunoreceptor tyrosine-based activation motif)-bearing receptors such as GP6. Regulates the strength of adhesion of ITGA2B/ ITGB3 activated receptors necessary for the cellular transmission of contractile forces. Required for platelet aggregation induced by F2 (thrombin) and thromboxane A2 (TXA2). Has a role in cell survival. May have a role in cell migration. Involved in the early stage of autophagosome formation. Modulates the intracellular level of PtdIns3P (phosphatidylinositol 3-phosphate) and activates PIK3C3 kinase activity. May act as a scaffold, independently of its lipid kinase activity to positively regulate autophagy. May have a role in insulin signaling as scaffolding protein in which the lipid kinase activity is not required. May have a kinase-independent function in regulating cell proliferation and in clathrin-mediated endocytosis. Mediator of oncogenic signal in cell lines lacking PTEN. The lipid kinase activity is necessary for its role in oncogenic transformation. Required for the growth of ERBB2 and RAS driven tumors. Has also a protein kinase activity showing autophosphorylation (PubMed : 12502714).
See full target information PIK3CB

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com