JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB161008

Recombinant Human PIBF protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human PIBF protein is a Human Fragment protein, in the 660 to 755 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

C13orf24, PIBF, PIBF1, Progesterone-induced-blocking factor 1, Centrosomal protein of 90 kDa, CEP90

1 Images
SDS-PAGE - Recombinant Human PIBF protein (AB161008)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human PIBF protein (AB161008)

ab161008 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

Q8WXW3

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"EKSALLQTKNQMALDLEQLLNHREELAAMKQILVKMHSKHSENSLLLTKTEPKHVTENQKSKTLNVPKEHEDNIFTPKPTLFTKKEAPEWSKKQKM","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":755,"aminoAcidStart":660,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q8WXW3","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The progesterone-induced blocking factor (PIBF) is a protein with a molecular mass of approximately 90 kDa. It has important roles linked to cell division and immune response regulation. PIBF is produced in larger quantities in pregnancy tissues particularly by decidual and trophoblastic cells but normal lymphocytes also express it when stimulated by progesterone. Researchers often study its activity because of its potential relevance in pregnancy and immune system interactions.
Biological function summary

Researchers already documented that PIBF plays a role in modulating immune responses during pregnancy. It acts as part of a complex involving progesterone and cytokines working to prevent the mother's immune system from rejecting the fetus. PIBF achieves this by influencing the Th1/Th2 cytokine balance increasing anti-inflammatory cytokines and decreasing pro-inflammatory cytokines like IL-6 and IL-12. This helps to maintain a tolerogenic environment during pregnancy.

Pathways

The PIBF significantly affects pathways involving immune regulation and inflammation. It interacts with the hormonal pathway of progesterone linking it to the immune-modulatory functions controlled by cytokine action. The balance between these pathways ensures immune tolerance in the placenta. PIBF also shares a functional pathway with proteins such as interleukin-10 (IL-10) as they both modulate immune responses to support successful pregnancies.

PIBF has significant associations with pregnancy-related conditions and certain cancers. Abnormal PIBF levels may relate to pregnancy complications such as recurrent spontaneous abortion where immune tolerance gets disrupted. Additionally PIBF can impact tumor growth because it promotes an immunosuppressive environment similar to that observed in pregnancy potentially benefiting malignant cells. This connection suggests that PIBF along with related proteins like IL-10 could serve as a target for therapeutic interventions in these conditions.

Specifications

Form

Liquid

General info

Function

Plays a role in ciliogenesis.. Isoform 1. Pericentriolar protein required to maintain mitotic spindle pole integrity (PubMed : 21224392). Required for the centrosomal accumulation of PCM1 and the recruitment of centriolar satellite proteins such as BBS4. Via association with PCM1 may be involved in primary cilia formation (PubMed : 23110211). Required for CEP63 centrosomal localization and its interaction with WDR62. Together with CEP63 promotes centriole duplication. Promotes the centrosomal localization of CDK2 (PubMed : 26297806).. Isoform 4. The secreted form is a mediator of progesterone that by acting on the phospholipase A2 enzyme interferes with arachidonic acid metabolism, induces a Th2 biased immune response, and by controlling decidual natural killer cells (NK) activity exerts an anti-abortive effect (PubMed : 12516630, PubMed : 14634107, PubMed : 3863495). Increases the production of Th2-type cytokines by signaling via the JAK/STAT pathway. Activates STAT6 and inhibits STAT4 phosphorylation. Signaling via a not identified receptor seems to implicate IL4R and a GPI-anchored protein (PubMed : 16393965, PubMed : 25218441).

Subcellular localisation

Cytoskeleton

Product protocols

Target data

Plays a role in ciliogenesis.. Isoform 1. Pericentriolar protein required to maintain mitotic spindle pole integrity (PubMed : 21224392). Required for the centrosomal accumulation of PCM1 and the recruitment of centriolar satellite proteins such as BBS4. Via association with PCM1 may be involved in primary cilia formation (PubMed : 23110211). Required for CEP63 centrosomal localization and its interaction with WDR62. Together with CEP63 promotes centriole duplication. Promotes the centrosomal localization of CDK2 (PubMed : 26297806).. Isoform 4. The secreted form is a mediator of progesterone that by acting on the phospholipase A2 enzyme interferes with arachidonic acid metabolism, induces a Th2 biased immune response, and by controlling decidual natural killer cells (NK) activity exerts an anti-abortive effect (PubMed : 12516630, PubMed : 14634107, PubMed : 3863495). Increases the production of Th2-type cytokines by signaling via the JAK/STAT pathway. Activates STAT6 and inhibits STAT4 phosphorylation. Signaling via a not identified receptor seems to implicate IL4R and a GPI-anchored protein (PubMed : 16393965, PubMed : 25218441).
See full target information PIBF1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com