JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152968

Recombinant Human PIWIL1 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human PIWIL1 protein (GST tag N-Terminus) is a Human Fragment protein, in the 431 to 541 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

HIWI, PIWIL1, Piwi-like protein 1

1 Images
SDS-PAGE - Recombinant Human PIWIL1 protein (GST tag N-Terminus) (AB152968)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human PIWIL1 protein (GST tag N-Terminus) (AB152968)

ab152968 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

Q96J94

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"NDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVDDRTEAY","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":541,"aminoAcidStart":431,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q96J94","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

PIWIL1 also known as Piwi-like protein 1 is a member of the Argonaute family with a molecular mass of approximately 97 kDa. This protein functions mechanically by binding to PIWI-interacting RNAs (piRNAs) which are small non-coding RNAs. PIWIL1 exhibits expression in germline cells specifically in testes therefore playing an important role in spermatogenesis. It facilitates the formation of piRNA complexes contributing to the regulation of gene silencing.
Biological function summary

PIWIL1 contributes to maintaining genomic integrity through its role in RNA-mediated gene regulation. It forms part of the piRNA-induced silencing complex. This complex targets transposable elements and prevents their mobility an important function for genomic stability. PIWIL1's involvement in gametogenesis highlights its essential function in reproductive biology and cellular processes where piRNA pathways operate.

Pathways

The PIWIL1 protein plays significant roles within the piRNA pathway which is important for transposon silencing and germline integrity. PIWIL1 interacts with MILI and MIWI two proteins that also participate in the silencing of transposable elements. This pathway intersects with other gene regulation pathways influencing the overall expression landscape necessary for proper cellular function in reproductive tissues.

PIWIL1 alterations have associations with germ cell tumors and fertility issues. Disruption in piRNA pathway components like PIWIL1 and its partners MIWI and MILI can lead to failures in genomic defense mechanisms influencing cancer development in germline cells. Additionally defects in PIWIL1 expression can contribute to infertility due to its role in spermatogenesis. Understanding these associations provides insights into potential diagnostic and therapeutic targets for related conditions.

Specifications

Form

Liquid

General info

Function

Endoribonuclease that plays a central role in postnatal germ cells by repressing transposable elements and preventing their mobilization, which is essential for the germline integrity. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and governs the methylation and subsequent repression of transposons. Directly binds methylated piRNAs, a class of 24 to 30 nucleotide RNAs that are generated by a Dicer-independent mechanism and are primarily derived from transposons and other repeated sequence elements. Strongly prefers a uridine in the first position of their guide (g1U preference, also named 1U-bias). Not involved in the piRNA amplification loop, also named ping-pong amplification cycle. Acts as an endoribonuclease that cleaves transposon messenger RNAs. Besides their function in transposable elements repression, piRNAs are probably involved in other processes during meiosis such as translation regulation. Probable component of some RISC complex, which mediates RNA cleavage and translational silencing. Also plays a role in the formation of chromatoid bodies and is required for some miRNAs stability. Required to sequester RNF8 in the cytoplasm until late spermatogenesis; RNF8 being released upon ubiquitination and degradation of PIWIL1.. Isoform 3. May be a negative developmental regulator (PubMed : 12037681, PubMed : 16287078).

Sequence similarities

Belongs to the argonaute family. Piwi subfamily.

Post-translational modifications

Arginine methylation by PRMT5 is required for the interaction with Tudor domain-containing protein (TDRD1, TDRKH/TDRD2, RNF17/TDRD4, TDRD6, TDRD7 and TDRD9) and subsequent localization to the meiotic nuage, also named P granule.. Ubiquitinated by the anaphase promoting complex/cyclosome (APC/C) in late spermatids, leading to its degradation (PubMed:28552346). Ubiquitination only takes place following piRNA-binding in adult testis (By similarity). Ubiquitination and degradation in late spermatogenesis by APC/C is probably required to release RNF8 from the cytoplasm and promote histone to protamine exchange by RNF8 (By similarity).

Product protocols

Target data

Endoribonuclease that plays a central role in postnatal germ cells by repressing transposable elements and preventing their mobilization, which is essential for the germline integrity. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and governs the methylation and subsequent repression of transposons. Directly binds methylated piRNAs, a class of 24 to 30 nucleotide RNAs that are generated by a Dicer-independent mechanism and are primarily derived from transposons and other repeated sequence elements. Strongly prefers a uridine in the first position of their guide (g1U preference, also named 1U-bias). Not involved in the piRNA amplification loop, also named ping-pong amplification cycle. Acts as an endoribonuclease that cleaves transposon messenger RNAs. Besides their function in transposable elements repression, piRNAs are probably involved in other processes during meiosis such as translation regulation. Probable component of some RISC complex, which mediates RNA cleavage and translational silencing. Also plays a role in the formation of chromatoid bodies and is required for some miRNAs stability. Required to sequester RNF8 in the cytoplasm until late spermatogenesis; RNF8 being released upon ubiquitination and degradation of PIWIL1.. Isoform 3. May be a negative developmental regulator (PubMed : 12037681, PubMed : 16287078).
See full target information PIWIL1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com