JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB200264

Recombinant human Plasminogen protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human Plasminogen protein (Active) is a Human Fragment protein, in the 98 to 356 aa range, expressed in Escherichia coli, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, HPLC.

View Alternative Names

Plasminogen, PLG

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Applications

HPLC, FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Fully biologically active when compared to standard. The activity is assayed on anti-proliferation and anti-migration of endothelial cells in vitro and antiangiogenesis in vivo. The specific activity of anti-migration of endothelial cells in vitro is 0.55×105Units/mg.

Accession

P00747

Animal free

No

Carrier free

No

Species

Human

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C.

Storage buffer

pH: 5.5 Constituents: 4% Mannitol, 0.16% Sodium acetate

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Endotoxin level determined by LAL method.

Sequence info

[{"sequence":"VYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSP","proteinLength":"Fragment","predictedMolecularWeight":"30 kDa","actualMolecularWeight":null,"aminoAcidEnd":356,"aminoAcidStart":98,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P00747","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Plasminogen also known as PLG is an important protein with a molecular weight of approximately 92 kDa. Plasminogen is a zymogen which means it is an inactive precursor that requires activation to function. It is produced primarily in the liver and circulates in blood plasma. Its expression occurs mainly in the liver but you can detect it in various tissues including the kidney. Plasminogen binds to tissue surfaces and undergoes transformation into plasmin an active enzyme that plays significant roles in many biological processes.
Biological function summary

Plasminogen plays a central role in fibrinolysis which is the breakdown of fibrin clots. This process is essential in wound healing and maintaining normal blood flow. Plasminogen once activated to plasmin acts by degrading fibrin a major component of blood clots. The protein forms part of the fibrinolytic system along with other components like tissue plasminogen activator (tPA). Together they ensure that any clots forming within blood vessels are regulated and dissolved as necessary preventing blockages.

Pathways

Plasminogen is deeply involved in the coagulation and fibrinolytic systems. The conversion of plasminogen to plasmin is a critical step in these pathways requiring activators such as urokinase. Plasminogen has interactions with proteins like alpha-2-antiplasmin and thrombin which help modulate its activity. These interactions ensure a careful balance is maintained between clot formation and dissolution which is vital for normal bodily function.

Plasminogen deficiency is linked with conditions like ligneous conjunctivitis a rare disorder characterized by membranous lesions mainly in the eyes. Reduced plasminogen activity can lead to excessive clot formation contributing to thrombosis risk. Plasminogen's interaction with plasmin and its deficiency can also associate with angioedema a condition that causes sudden swelling in the deeper layers of skin and tissues. Understanding the pathways and the proteins involved in plasminogen's function presents therapeutic potential in managing these disorders.

Specifications

Form

Lyophilized

Additional notes

>95% HPLC analyses.

General info

Function

Plasmin dissolves the fibrin of blood clots and acts as a proteolytic factor in a variety of other processes including embryonic development, tissue remodeling, tumor invasion, and inflammation. In ovulation, weakens the walls of the Graafian follicle. It activates the urokinase-type plasminogen activator, collagenases and several complement zymogens, such as C1 and C5. Cleavage of fibronectin and laminin leads to cell detachment and apoptosis. Also cleaves fibrin, thrombospondin and von Willebrand factor. Its role in tissue remodeling and tumor invasion may be modulated by CSPG4. Binds to cells.. Angiostatin is an angiogenesis inhibitor that blocks neovascularization and growth of experimental primary and metastatic tumors in vivo.. (Microbial infection) ENO/enoloase from parasite P.falciparum (strain NF54) interacts with PLG present in the mosquito blood meal to promote the invasion of the mosquito midgut by the parasite ookinete (PubMed : 21949403). The catalytic active form, plasmin, is essential for the invasion of the mosquito midgut (PubMed : 21949403).. (Microbial infection) Binds to OspC on the surface of B.burgdorferi cells, possibly conferring an extracellular protease activity on the bacteria that allows it to traverse host tissue.

Sequence similarities

Belongs to the peptidase S1 family. Plasminogen subfamily.

Post-translational modifications

N-linked glycan contains N-acetyllactosamine and sialic acid. O-linked glycans consist of Gal-GalNAc disaccharide modified with up to 2 sialic acid residues (microheterogeneity).. In the presence of the inhibitor, the activation involves only cleavage after Arg-580, yielding two chains held together by two disulfide bonds. In the absence of the inhibitor, the activation involves additionally the removal of the activation peptide.. (Microbial infection) The Y.pestis Pla protein cleaves between Arg-580 and Val-581, generating plasmin which facilitates bacterial migration and infection (PubMed:22645135).

Product protocols

Target data

Plasmin dissolves the fibrin of blood clots and acts as a proteolytic factor in a variety of other processes including embryonic development, tissue remodeling, tumor invasion, and inflammation. In ovulation, weakens the walls of the Graafian follicle. It activates the urokinase-type plasminogen activator, collagenases and several complement zymogens, such as C1 and C5. Cleavage of fibronectin and laminin leads to cell detachment and apoptosis. Also cleaves fibrin, thrombospondin and von Willebrand factor. Its role in tissue remodeling and tumor invasion may be modulated by CSPG4. Binds to cells.. Angiostatin is an angiogenesis inhibitor that blocks neovascularization and growth of experimental primary and metastatic tumors in vivo.. (Microbial infection) ENO/enoloase from parasite P.falciparum (strain NF54) interacts with PLG present in the mosquito blood meal to promote the invasion of the mosquito midgut by the parasite ookinete (PubMed : 21949403). The catalytic active form, plasmin, is essential for the invasion of the mosquito midgut (PubMed : 21949403).. (Microbial infection) Binds to OspC on the surface of B.burgdorferi cells, possibly conferring an extracellular protease activity on the bacteria that allows it to traverse host tissue.
See full target information PLG

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com