JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB171583

Recombinant Human POLD4 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human POLD4 protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 107 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

POLDS, POLD4, DNA polymerase delta subunit 4, DNA polymerase delta subunit p12

1 Images
SDS-PAGE - Recombinant Human POLD4 protein (His tag N-Terminus) (AB171583)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human POLD4 protein (His tag N-Terminus) (AB171583)

15% SDS-PAGE analysis of ab171583 at 3ug.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q9HCU8

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 40% Glycerol (glycerin, glycerine), 1.17% Sodium chloride, 0.32% Tris HCl, 0.03% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLRQFDLAWQYGPCTGITRLQRWCRAKQMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYPL","proteinLength":"Full Length","predictedMolecularWeight":"14.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":107,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9HCU8","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

POLD4 also known as DNA polymerase delta subunit 4 functions as a component of the DNA polymerase delta complex assisting in DNA replication and repair mechanisms. This protein has a molecular mass of approximately 12 kDa and is expressed in various tissues including those with high proliferative rates such as the spleen and thymus. As a part of the DNA polymerase delta complex POLD4 contributes to polymerase and exonuclease activities required during cell division.
Biological function summary

POLD4 plays an integral role in maintaining genomic stability through its function as part of the DNA polymerase delta complex. It is involved in synthesizing the lagging strand during DNA replication and facilitates repair through DNA mismatch repair processes. Its activity ensures accurate DNA synthesis thereby preventing mutations that might otherwise propagate during cell division. Interactions with proliferating cell nuclear antigen (PCNA) and other subunits of the polymerase delta complex POLD1 POLD2 and POLD3 are important for its function.

Pathways

POLD4 participates in essential DNA replication and repair pathways. It plays a role in the replication fork by ensuring the fidelity of DNA synthesis coordinating with the proteins MSH2 and MLH1 in the mismatch repair pathway. Additionally POLD4's interaction with the replicative DNA helicase complex highlights its involvement in the initiation and elongation phases of DNA replication important for S-phase progression.

POLD4's involvement in DNA replication and repair processes links it to cancer progression. Mutations or dysregulation in POLD4 can lead to genomic instability often observed in various cancers due to defective mismatch repair. The connection between POLD4 and mismatch repair proteins like MSH2 is significant in cancers with microsatellite instability. Additionally POLD4's function is under investigation in relation to neurodegenerative disorders where DNA repair deficits contribute to disease pathology.

Specifications

Form

Liquid

Additional notes

ab171583 was purified using conventional chromatography.

General info

Function

As a component of the tetrameric DNA polymerase delta complex (Pol-delta4), plays a role in high fidelity genome replication and repair. Within this complex, increases the rate of DNA synthesis and decreases fidelity by regulating POLD1 polymerase and proofreading 3' to 5' exonuclease activity (PubMed : 16510448, PubMed : 19074196, PubMed : 20334433). Pol-delta4 participates in Okazaki fragment processing, through both the short flap pathway, as well as a nick translation system (PubMed : 24035200). Under conditions of DNA replication stress, required for the repair of broken replication forks through break-induced replication (BIR), a mechanism that may induce segmental genomic duplications of up to 200 kb (PubMed : 24310611). Involved in Pol-delta4 translesion synthesis (TLS) of templates carrying O6-methylguanine or abasic sites (PubMed : 19074196). Its degradation in response to DNA damage is required for the inhibition of fork progression and cell survival (PubMed : 24022480).

Sequence similarities

Belongs to the DNA polymerase delta subunit 4 family.

Post-translational modifications

Ubiquitinated; undergoes 'Lys-48'-linked ubiquitination in response to UV irradiation, leading to proteasomal degradation (PubMed:16934752, PubMed:17317665, PubMed:23233665, PubMed:23913683). This modification is partly mediated by RNF8 and by the DCX(DTL) E3 ubiquitin ligase complex (also called CRL4(CDT2)) (PubMed:23233665, PubMed:24022480). Efficient degradation requires the presence of PCNA and is required for the inhibition of fork progression after DNA damage (PubMed:24022480).

Subcellular localisation

Nucleus

Product protocols

Target data

As a component of the tetrameric DNA polymerase delta complex (Pol-delta4), plays a role in high fidelity genome replication and repair. Within this complex, increases the rate of DNA synthesis and decreases fidelity by regulating POLD1 polymerase and proofreading 3' to 5' exonuclease activity (PubMed : 16510448, PubMed : 19074196, PubMed : 20334433). Pol-delta4 participates in Okazaki fragment processing, through both the short flap pathway, as well as a nick translation system (PubMed : 24035200). Under conditions of DNA replication stress, required for the repair of broken replication forks through break-induced replication (BIR), a mechanism that may induce segmental genomic duplications of up to 200 kb (PubMed : 24310611). Involved in Pol-delta4 translesion synthesis (TLS) of templates carrying O6-methylguanine or abasic sites (PubMed : 19074196). Its degradation in response to DNA damage is required for the inhibition of fork progression and cell survival (PubMed : 24022480).
See full target information POLD4

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com