JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB271410

Recombinant Human Poliovirus Receptor/PVR protein (Tagged)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Poliovirus Receptor/PVR protein (Tagged) is a Human Fragment protein, in the 27 to 343 aa range, expressed in HEK 293 cells, with >90%, suitable for SDS-PAGE.

View Alternative Names

CD155, PVS, PVR, Poliovirus receptor, Nectin-like protein 5, NECL-5

1 Images
SDS-PAGE - Recombinant Human Poliovirus Receptor/PVR protein (Tagged) (AB271410)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Poliovirus Receptor/PVR protein (Tagged) (AB271410)

SDS-PAGE analysis of ab271410.

Key facts

Purity

>90% SDS-PAGE

Expression system

HEK 293 cells

Tags

Fc tag C-Terminus Avi tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P15151

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.13% Sodium phosphate, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK","proteinLength":"Fragment","predictedMolecularWeight":"63 kDa","actualMolecularWeight":null,"aminoAcidEnd":343,"aminoAcidStart":27,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"P15151","tags":[{"tag":"Fc","terminus":"C-Terminus"},{"tag":"Avi","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The Poliovirus Receptor (PVR) also known as CD155 is a cell surface glycoprotein with a molecular mass of approximately 70 kDa. This receptor is expressed on a variety of cell types including epithelial and endothelial cells immune cells and fibroblasts. Another name for PVR is Necl-5 which falls under the nectin-like molecule family. It acts as an adhesion molecule and contributes to cellular signaling and junctional complexes. The expression of PVR is widespread across multiple tissues but it exhibits stronger expression in areas such as the skin and the gastrointestinal tract.
Biological function summary

The Poliovirus Receptor plays meaningful roles in immune response modulation and cell-cell adhesion. PVR interacts with components of the immune system and forms complexes with other proteins like CD226 and TIGIT. These interactions help regulate immune cell activities especially in the context of natural killer (NK) cells and T-cells. The CD155 protein also links to migration and proliferation processes which are essential for tissue formation and repair.

Pathways

PVR is involved in the regulation of immune and signaling pathways. It fits into pathways like NK cell activation and T-cell inhibitory signaling which are important for maintaining immune tolerance and preventing autoimmunity. In these pathways PVR interacts closely with other immunoregulatory proteins including CD226 and TIGIT. The partnership of PVR with these proteins shapes the delicate balance between immune activation and suppression demonstrating a clear role in immune homeostasis.

PVR relates to conditions such as cancer and viral infection. Its overexpression or altered signaling has been observed in several cancers where it may contribute to tumor growth and immune evasion. The interaction between PVR and its related protein TIGIT can affect antitumor immune responses complicating cancer progression. Additionally as its name suggests PVR binds to the poliovirus facilitating viral entry and spread during infection. This highlights the importance of PVR not only in pathogenic interactions but also in broader immune response contexts.

Specifications

Form

Liquid

General info

Function

Mediates NK cell adhesion and triggers NK cell effector functions. Binds two different NK cell receptors : CD96 and CD226. These interactions accumulates at the cell-cell contact site, leading to the formation of a mature immunological synapse between NK cell and target cell. This may trigger adhesion and secretion of lytic granules and IFN-gamma and activate cytotoxicity of activated NK cells. May also promote NK cell-target cell modular exchange, and PVR transfer to the NK cell. This transfer is more important in some tumor cells expressing a lot of PVR, and may trigger fratricide NK cell activation, providing tumors with a mechanism of immunoevasion. Plays a role in mediating tumor cell invasion and migration.. (Microbial infection) Acts as a receptor for poliovirus. May play a role in axonal transport of poliovirus, by targeting virion-PVR-containing endocytic vesicles to the microtubular network through interaction with DYNLT1. This interaction would drive the virus-containing vesicle to the axonal retrograde transport.. (Microbial infection) Acts as a receptor for Pseudorabies virus.. (Microbial infection) Is prevented to reach cell surface upon infection by Human cytomegalovirus /HHV-5, presumably to escape immune recognition of infected cell by NK cells.

Sequence similarities

Belongs to the nectin family.

Post-translational modifications

N-glycosylated. N-glycan at Asn-120: Hex5HexNAc4.. Phosphorylated by Src kinases on tyrosine residues in the ITIM motif upon ligation. Interaction with TIGIT is required for Phosphorylation.

Product protocols

Target data

Mediates NK cell adhesion and triggers NK cell effector functions. Binds two different NK cell receptors : CD96 and CD226. These interactions accumulates at the cell-cell contact site, leading to the formation of a mature immunological synapse between NK cell and target cell. This may trigger adhesion and secretion of lytic granules and IFN-gamma and activate cytotoxicity of activated NK cells. May also promote NK cell-target cell modular exchange, and PVR transfer to the NK cell. This transfer is more important in some tumor cells expressing a lot of PVR, and may trigger fratricide NK cell activation, providing tumors with a mechanism of immunoevasion. Plays a role in mediating tumor cell invasion and migration.. (Microbial infection) Acts as a receptor for poliovirus. May play a role in axonal transport of poliovirus, by targeting virion-PVR-containing endocytic vesicles to the microtubular network through interaction with DYNLT1. This interaction would drive the virus-containing vesicle to the axonal retrograde transport.. (Microbial infection) Acts as a receptor for Pseudorabies virus.. (Microbial infection) Is prevented to reach cell surface upon infection by Human cytomegalovirus /HHV-5, presumably to escape immune recognition of infected cell by NK cells.
See full target information PVR

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com