JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB268879

Recombinant human PPP2R1A + PP2A alpha protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human PPP2R1A + PP2A alpha protein (Active) is a Human Full Length protein, in the 1 to 309 aa range, expressed in Baculovirus infected Sf9 cells, with >75%, suitable for SDS-PAGE, FuncS.

View Alternative Names

Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform, PP2Aa, Medium tumor antigen-associated 61 kDa protein, PP2A subunit A isoform PR65-alpha, PP2A subunit A isoform R1-alpha, PPP2R1A, Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha, Replication protein C, RP-C, PPP2CA

2 Images
Functional Studies - Recombinant human PPP2R1A + PP2A alpha protein (Active) (AB268879)
  • FuncS

Supplier Data

Functional Studies - Recombinant human PPP2R1A + PP2A alpha protein (Active) (AB268879)

The specific activity of ab268879 was ~ 4,000 nmol phosphate released/min/mg in an assay using a Thr-triphosphopeptide substrate (KRT(p)IRR).

SDS-PAGE - Recombinant human PPP2R1A + PP2A alpha protein (Active) (AB268879)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human PPP2R1A + PP2A alpha protein (Active) (AB268879)

SDS-PAGE analysis of ab268879.

Key facts

Purity

>75% SDS-PAGE

Expression system

Baculovirus infected Sf9 cells

Tags

Tag free

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

The specific activity of ab268879 was ~ 4,000 nmol phosphate released/min/mg in an assay using a Thr-triphosphopeptide substrate (KRT(p)IRR).

Accession

P30153

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7 Preservative: 1.02% Imidazole Constituents: 25% Glycerol (glycerin, glycerine), 1.74% Sodium chloride, 1.05% MOPS, 0.004% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.002% PMSF

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Proteins co-expressed.

Sequence info

[{"sequence":"MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":309,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf9 cells","accessionNumber":"P67775","tags":[{"tag":"His","terminus":"N-Terminus"}]},{"sequence":"","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":0,"aminoAcidStart":0,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"P30153","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

PPP2R1A also referred to as PP2A alpha is a regulatory subunit of the protein phosphatase 2A (PP2A) complex. The protein has a mass of approximately 65 kDa. It functions mechanically as a scaffold subunit within the PP2A holoenzyme serving to coordinate the interaction between catalytic and regulatory subunits of the complex. This protein is widely expressed across various tissues which reflects its role in numerous cellular processes.
Biological function summary

The activity of PPP2R1A is essential for the dephosphorylation of serine/threonine residues on proteins allowing significant regulation of various cellular functions. The protein is an important part of the PP2A complex a heterotrimer that consists of structural (A) catalytic (C) and regulatory (B) subunits. This complex contributes to the control of cell growth and division by maintaining appropriate levels of phosphorylation within the cell impacting various signaling pathways.

Pathways

The functional activity of PPP2R1A integrates into critical pathways like the MAPK signaling pathway and cell cycle regulation. It modulates the activities of kinases and other proteins such as AKT and MEK which are critical to these pathways and are important in processes like cell proliferation and apoptosis. PPP2R1A's regulatory role ensures proper signal transduction within these pathways for maintaining cellular homeostasis.

The malfunction or mutation of PPP2R1A has been linked to cancers such as lung and colorectal cancer. Aberrant signaling within the pathways it regulates can lead to unregulated cell growth and contribute to tumorigenesis. Furthermore the protein's dysfunction can be associated with disorders connected to AKT signaling dysregulation reinforcing the importance of PPP2R1A's role in maintaining cellular structure and function.

Specifications

Form

Liquid

Additional notes

Affinity purified.

General info

Function

The PR65 subunit of protein phosphatase 2A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit (PubMed : 15525651, PubMed : 16580887, PubMed : 33243860, PubMed : 33633399, PubMed : 34004147, PubMed : 8694763). Upon interaction with GNA12 promotes dephosphorylation of microtubule associated protein TAU/MAPT (PubMed : 15525651). Required for proper chromosome segregation and for centromeric localization of SGO1 in mitosis (PubMed : 16580887). Together with RACK1 adapter, mediates dephosphorylation of AKT1 at 'Ser-473', preventing AKT1 activation and AKT-mTOR signaling pathway (By similarity). Dephosphorylation of AKT1 is essential for regulatory T-cells (Treg) homeostasis and stability (By similarity). Part of the striatin-interacting phosphatase and kinase (STRIPAK) complexes (PubMed : 18782753, PubMed : 33633399). STRIPAK complexes have critical roles in protein (de)phosphorylation and are regulators of multiple signaling pathways including Hippo, MAPK, nuclear receptor and cytoskeleton remodeling (PubMed : 18782753, PubMed : 33633399). Different types of STRIPAK complexes are involved in a variety of biological processes such as cell growth, differentiation, apoptosis, metabolism and immune regulation (PubMed : 18782753, PubMed : 33633399). Key mediator of a quality checkpoint during transcription elongation as part of the Integrator-PP2A (INTAC) complex (PubMed : 33243860, PubMed : 34004147). The INTAC complex drives premature transcription termination of transcripts that are unfavorably configured for transcriptional elongation : within the INTAC complex, acts as a scaffolding subunit for PPP2CA, which catalyzes dephosphorylation of the C-terminal domain (CTD) of Pol II subunit POLR2A/RPB1 and SUPT5H/SPT5, thereby preventing transcriptional elongation (PubMed : 33243860, PubMed : 34004147). Regulates the recruitment of the SKA complex to kinetochores (PubMed : 28982702).

Sequence similarities

Belongs to the phosphatase 2A regulatory subunit A family.

Subcellular localisation

Nucleus

Product protocols

Target data

The PR65 subunit of protein phosphatase 2A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit (PubMed : 15525651, PubMed : 16580887, PubMed : 33243860, PubMed : 33633399, PubMed : 34004147, PubMed : 8694763). Upon interaction with GNA12 promotes dephosphorylation of microtubule associated protein TAU/MAPT (PubMed : 15525651). Required for proper chromosome segregation and for centromeric localization of SGO1 in mitosis (PubMed : 16580887). Together with RACK1 adapter, mediates dephosphorylation of AKT1 at 'Ser-473', preventing AKT1 activation and AKT-mTOR signaling pathway (By similarity). Dephosphorylation of AKT1 is essential for regulatory T-cells (Treg) homeostasis and stability (By similarity). Part of the striatin-interacting phosphatase and kinase (STRIPAK) complexes (PubMed : 18782753, PubMed : 33633399). STRIPAK complexes have critical roles in protein (de)phosphorylation and are regulators of multiple signaling pathways including Hippo, MAPK, nuclear receptor and cytoskeleton remodeling (PubMed : 18782753, PubMed : 33633399). Different types of STRIPAK complexes are involved in a variety of biological processes such as cell growth, differentiation, apoptosis, metabolism and immune regulation (PubMed : 18782753, PubMed : 33633399). Key mediator of a quality checkpoint during transcription elongation as part of the Integrator-PP2A (INTAC) complex (PubMed : 33243860, PubMed : 34004147). The INTAC complex drives premature transcription termination of transcripts that are unfavorably configured for transcriptional elongation : within the INTAC complex, acts as a scaffolding subunit for PPP2CA, which catalyzes dephosphorylation of the C-terminal domain (CTD) of Pol II subunit POLR2A/RPB1 and SUPT5H/SPT5, thereby preventing transcriptional elongation (PubMed : 33243860, PubMed : 34004147). Regulates the recruitment of the SKA complex to kinetochores (PubMed : 28982702).
See full target information Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform

Additional targets

PPP2CA

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com