JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB271717

Recombinant human PPP2R1A + PP2A-alpha protein (Active) (6x His tag N-Terminus, GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human PPP2R1A + PP2A-alpha protein (Active) (6x His tag N-Terminus, GST tag N-Terminus) is a Human Full Length protein, in the 2 to 309 aa range, expressed in Baculovirus infected Sf9 cells, with >80%, suitable for SDS-PAGE, FuncS.

View Alternative Names

Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha, Replication protein C, RP-C, PPP2CA, Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform, PP2Aa, Medium tumor antigen-associated 61 kDa protein, PP2A subunit A isoform PR65-alpha, PP2A subunit A isoform R1-alpha, PPP2R1A

2 Images
Functional Studies - Recombinant human PPP2R1A + PP2A-alpha protein (Active) (6x His tag N-Terminus, GST tag N-Terminus) (AB271717)
  • FuncS

Unknown

Functional Studies - Recombinant human PPP2R1A + PP2A-alpha protein (Active) (6x His tag N-Terminus, GST tag N-Terminus) (AB271717)

Specific activity of ab271717 was ≥100 pmol/min/μg.

SDS-PAGE - Recombinant human PPP2R1A + PP2A-alpha protein (Active) (6x His tag N-Terminus, GST tag N-Terminus) (AB271717)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant human PPP2R1A + PP2A-alpha protein (Active) (6x His tag N-Terminus, GST tag N-Terminus) (AB271717)

SDS-PAGE analysis of 4 μg ab271717.

Key facts

Purity

>80% SDS-PAGE

Expression system

Baculovirus infected Sf9 cells

Tags

Tag free

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Specific Activity: ≥100 pmol/min/μg.

Assay Conditions: 20 mM HEPES, pH 7.2, 100 mM NaCl, 3 mM DTT, 10 mM pNPP and PP2A. Assay was peformed at 37°C for 40 min, and the reaction progress was measured at 405 nm. Specific activity was calculated based on pNPP= 18,000 M-1cm-1.

Accession

P67775

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.49% Glutathione, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"DEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL","proteinLength":"Full Length","predictedMolecularWeight":"36 kDa","actualMolecularWeight":null,"aminoAcidEnd":309,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"P67775","tags":[{"tag":"6x His","terminus":"N-Terminus"}]},{"sequence":"AAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA","proteinLength":"Full Length","predictedMolecularWeight":"92 kDa","actualMolecularWeight":null,"aminoAcidEnd":589,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf9 cells","accessionNumber":"P30153","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The protein PPP2R1A also known as PP2A-alpha functions mechanically as the scaffold subunit of the protein phosphatase 2A (PP2A) complex. PP2A is a serine/threonine protein phosphatase that plays an important role in cell function regulation through dephosphorylation of its target proteins. PPP2R1A has a molecular mass of about 65 kDa. It is expressed in a wide variety of tissues with significant expression in the brain and heart. This broad expression indicates its involvement in fundamental cellular functions.
Biological function summary

The PP2A complex of which PPP2R1A is a critical component regulates a range of cellular processes such as cell cycle progression apoptosis and cellular signaling. The protein is a part of the PP2A holoenzyme complex including catalytic and regulatory subunits. This complex association allows PP2A to exert its effects on multiple substrates influencing pathways that govern cellular homeostasis and response to external signals.

Pathways

The phosphatase activity of PP2A places it centrally in pathways like the cell growth and survival pathway notably involving the AKT signaling pathway and the Wnt signaling pathway which is vital for cell development and differentiation. Within these pathways PPP2R1A interacts with proteins such as AKT and GSK-3β helping regulate their phosphorylation states thereby modulating their activity and overall pathway outcomes.

Mutations or alterations in PPP2R1A have been associated with specific cancers particularly endometrial carcinoma and ovarian cancer. These mutations can lead to dysregulation of PP2A activity affecting cell proliferation and survival. The connection of PPP2R1A with these diseases also highlights interaction with other proteins such as MYC as PP2A is known to modulate MYC phosphorylation and function. This link positions PPP2R1A as a potential therapeutic target in cancer treatment strategies.

Specifications

Form

Liquid

Additional notes

Affinity purified.

General info

Function

Catalytic subunit of protein phosphatase 2A (PP2A), a serine/threonine phosphatase involved in the regulation of a wide variety of enzymes, signal transduction pathways, and cellular events (PubMed : 10801873, PubMed : 12473674, PubMed : 17245430, PubMed : 22613722, PubMed : 33243860, PubMed : 34004147, PubMed : 9920888). PP2A is the major phosphatase for microtubule-associated proteins (MAPs) (PubMed : 22613722). PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase (PubMed : 22613722). Cooperates with SGO2 to protect centromeric cohesin from separase-mediated cleavage in oocytes specifically during meiosis I (By similarity). Can dephosphorylate various proteins, such as SV40 large T antigen, AXIN1, p53/TP53, PIM3, WEE1 (PubMed : 10801873, PubMed : 12473674, PubMed : 17245430, PubMed : 9920888). Activates RAF1 by dephosphorylating it at 'Ser-259' (PubMed : 10801873). Mediates dephosphorylation of WEE1, preventing its ubiquitin-mediated proteolysis, increasing WEE1 protein levels, and promoting the G2/M checkpoint (PubMed : 33108758). Mediates dephosphorylation of MYC; promoting its ubiquitin-mediated proteolysis : interaction with AMBRA1 enhances interaction between PPP2CA and MYC (PubMed : 25438055). Mediates dephosphorylation of FOXO3; promoting its stabilization : interaction with AMBRA1 enhances interaction between PPP2CA and FOXO3 (PubMed : 30513302). Catalyzes dephosphorylation of the pyrin domain of NLRP3, promoting assembly of the NLRP3 inflammasome (By similarity). Together with RACK1 adapter, mediates dephosphorylation of AKT1 at 'Ser-473', preventing AKT1 activation and AKT-mTOR signaling pathway (By similarity). Dephosphorylation of AKT1 is essential for regulatory T-cells (Treg) homeostasis and stability (By similarity). Catalyzes dephosphorylation of PIM3, promoting PIM3 ubiquitination and proteasomal degradation (PubMed : 12473674). Part of the striatin-interacting phosphatase and kinase (STRIPAK) complexes (PubMed : 33633399). STRIPAK complexes have critical roles in protein (de)phosphorylation and are regulators of multiple signaling pathways including Hippo, MAPK, nuclear receptor and cytoskeleton remodeling (PubMed : 33633399). Different types of STRIPAK complexes are involved in a variety of biological processes such as cell growth, differentiation, apoptosis, metabolism and immune regulation (PubMed : 33633399). Key mediator of a quality checkpoint during transcription elongation as part of the Integrator-PP2A (INTAC) complex (PubMed : 33243860, PubMed : 34004147, PubMed : 37080207). The INTAC complex drives premature transcription termination of transcripts that are unfavorably configured for transcriptional elongation : within the INTAC complex, PPP2CA catalyzes dephosphorylation of the C-terminal domain (CTD) of Pol II subunit POLR2A/RPB1 and SUPT5H/SPT5, thereby preventing transcriptional elongation (PubMed : 33243860, PubMed : 34004147, PubMed : 37080207).

Sequence similarities

Belongs to the PPP phosphatase family. PP-1 subfamily.

Post-translational modifications

Reversibly methyl esterified on Leu-309 by leucine carboxyl methyltransferase 1 (LCMT1) and protein phosphatase methylesterase 1 (PPME1). Carboxyl methylation influences the affinity of the catalytic subunit for the different regulatory subunits, thereby modulating the PP2A holoenzyme's substrate specificity, enzyme activity and cellular localization.. Phosphorylation of either threonine (by autophosphorylation-activated protein kinase) or tyrosine results in inactivation of the phosphatase. Auto-dephosphorylation has been suggested as a mechanism for reactivation.. Polyubiquitinated, leading to its degradation by the proteasome.

Subcellular localisation

Nucleus

Product protocols

Target data

Catalytic subunit of protein phosphatase 2A (PP2A), a serine/threonine phosphatase involved in the regulation of a wide variety of enzymes, signal transduction pathways, and cellular events (PubMed : 10801873, PubMed : 12473674, PubMed : 17245430, PubMed : 22613722, PubMed : 33243860, PubMed : 34004147, PubMed : 9920888). PP2A is the major phosphatase for microtubule-associated proteins (MAPs) (PubMed : 22613722). PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase (PubMed : 22613722). Cooperates with SGO2 to protect centromeric cohesin from separase-mediated cleavage in oocytes specifically during meiosis I (By similarity). Can dephosphorylate various proteins, such as SV40 large T antigen, AXIN1, p53/TP53, PIM3, WEE1 (PubMed : 10801873, PubMed : 12473674, PubMed : 17245430, PubMed : 9920888). Activates RAF1 by dephosphorylating it at 'Ser-259' (PubMed : 10801873). Mediates dephosphorylation of WEE1, preventing its ubiquitin-mediated proteolysis, increasing WEE1 protein levels, and promoting the G2/M checkpoint (PubMed : 33108758). Mediates dephosphorylation of MYC; promoting its ubiquitin-mediated proteolysis : interaction with AMBRA1 enhances interaction between PPP2CA and MYC (PubMed : 25438055). Mediates dephosphorylation of FOXO3; promoting its stabilization : interaction with AMBRA1 enhances interaction between PPP2CA and FOXO3 (PubMed : 30513302). Catalyzes dephosphorylation of the pyrin domain of NLRP3, promoting assembly of the NLRP3 inflammasome (By similarity). Together with RACK1 adapter, mediates dephosphorylation of AKT1 at 'Ser-473', preventing AKT1 activation and AKT-mTOR signaling pathway (By similarity). Dephosphorylation of AKT1 is essential for regulatory T-cells (Treg) homeostasis and stability (By similarity). Catalyzes dephosphorylation of PIM3, promoting PIM3 ubiquitination and proteasomal degradation (PubMed : 12473674). Part of the striatin-interacting phosphatase and kinase (STRIPAK) complexes (PubMed : 33633399). STRIPAK complexes have critical roles in protein (de)phosphorylation and are regulators of multiple signaling pathways including Hippo, MAPK, nuclear receptor and cytoskeleton remodeling (PubMed : 33633399). Different types of STRIPAK complexes are involved in a variety of biological processes such as cell growth, differentiation, apoptosis, metabolism and immune regulation (PubMed : 33633399). Key mediator of a quality checkpoint during transcription elongation as part of the Integrator-PP2A (INTAC) complex (PubMed : 33243860, PubMed : 34004147, PubMed : 37080207). The INTAC complex drives premature transcription termination of transcripts that are unfavorably configured for transcriptional elongation : within the INTAC complex, PPP2CA catalyzes dephosphorylation of the C-terminal domain (CTD) of Pol II subunit POLR2A/RPB1 and SUPT5H/SPT5, thereby preventing transcriptional elongation (PubMed : 33243860, PubMed : 34004147, PubMed : 37080207).
See full target information PPP2CA

Additional targets

Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com