JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB126687

Recombinant Human PQBP1 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human PQBP1 protein is a Human Full Length protein, in the 1 to 265 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

NPW38, JM26, PQBP1, Polyglutamine-binding protein 1, PQBP-1, 38 kDa nuclear protein containing a WW domain, Polyglutamine tract-binding protein 1, Npw38

1 Images
SDS-PAGE - Recombinant Human PQBP1 protein (AB126687)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human PQBP1 protein (AB126687)

3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

O60828

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSHMPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDRDRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD","proteinLength":"Full Length","predictedMolecularWeight":"33 kDa","actualMolecularWeight":null,"aminoAcidEnd":265,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O60828","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

PQBP1 also known as Polyglutamine-Binding Protein 1 is a protein that plays an important role in cellular functions. Its molecular mass is approximately 34 kDa. PQBP1 is expressed widely in human tissues with higher levels detected in the brain and muscle. It contains a WW domain which facilitates its interaction with other proteins through proline-rich sequences impacting various cellular processes such as transcriptional regulation and RNA splicing.
Biological function summary

PQBP1 interacts with other proteins through its ability to bind to polyglutamine tracts. This protein often participates as a subunit in large complexes influencing the transcriptional machinery. It plays a role by regulating gene expression and maintaining proper RNA splicing which are critical for normal cell function and development. The ability to form complexes enables PQBP1 to impact multiple pathways critical for cellular processes highlighting its functional versatility.

Pathways

PQBP1 actively participates in the RNA splicing pathway and transcription regulation. It interacts closely with the WNT signaling pathway which is vital for cellular proliferation and differentiation. Within these pathways PQBP1 associates with proteins like ATXN1 and SMN facilitating its role in gene expression modulation and maintaining cellular homeostasis.

PQBP1 mutations are linked to neurological conditions such as Renpenning syndrome and intellectual disability. These mutations can alter the PQBP1's interaction with other proteins including those in the WNT pathway potentially leading to disrupted cellular functions. The protein ATXN1 connected through disease pathways interacts with PQBP1 amplifying the effects of its mutations and contributing to the pathology of neurodegenerative diseases.

Specifications

Form

Liquid

Additional notes

purified by using conventional chromatography techniques.

General info

Function

Intrinsically disordered protein that acts as a scaffold, and which is involved in different processes, such as pre-mRNA splicing, transcription regulation, innate immunity and neuron development (PubMed : 10198427, PubMed : 10332029, PubMed : 12062018, PubMed : 20410308, PubMed : 23512658). Interacts with splicing-related factors via the intrinsically disordered region and regulates alternative splicing of target pre-mRNA species (PubMed : 10332029, PubMed : 12062018, PubMed : 20410308, PubMed : 23512658). May suppress the ability of POU3F2 to transactivate the DRD1 gene in a POU3F2 dependent manner. Can activate transcription directly or via association with the transcription machinery (PubMed : 10198427). May be involved in ATXN1 mutant-induced cell death (PubMed : 12062018). The interaction with ATXN1 mutant reduces levels of phosphorylated RNA polymerase II large subunit (PubMed : 12062018). Involved in the assembly of cytoplasmic stress granule, possibly by participating in the transport of neuronal RNA granules (PubMed : 21933836). Also acts as an innate immune sensor of infection by retroviruses, such as HIV, by detecting the presence of reverse-transcribed DNA in the cytosol (PubMed : 26046437). Directly binds retroviral reverse-transcribed DNA in the cytosol and interacts with CGAS, leading to activate the cGAS-STING signaling pathway, triggering type-I interferon production (PubMed : 26046437).

Subcellular localisation

Nucleus

Product protocols

Target data

Intrinsically disordered protein that acts as a scaffold, and which is involved in different processes, such as pre-mRNA splicing, transcription regulation, innate immunity and neuron development (PubMed : 10198427, PubMed : 10332029, PubMed : 12062018, PubMed : 20410308, PubMed : 23512658). Interacts with splicing-related factors via the intrinsically disordered region and regulates alternative splicing of target pre-mRNA species (PubMed : 10332029, PubMed : 12062018, PubMed : 20410308, PubMed : 23512658). May suppress the ability of POU3F2 to transactivate the DRD1 gene in a POU3F2 dependent manner. Can activate transcription directly or via association with the transcription machinery (PubMed : 10198427). May be involved in ATXN1 mutant-induced cell death (PubMed : 12062018). The interaction with ATXN1 mutant reduces levels of phosphorylated RNA polymerase II large subunit (PubMed : 12062018). Involved in the assembly of cytoplasmic stress granule, possibly by participating in the transport of neuronal RNA granules (PubMed : 21933836). Also acts as an innate immune sensor of infection by retroviruses, such as HIV, by detecting the presence of reverse-transcribed DNA in the cytosol (PubMed : 26046437). Directly binds retroviral reverse-transcribed DNA in the cytosol and interacts with CGAS, leading to activate the cGAS-STING signaling pathway, triggering type-I interferon production (PubMed : 26046437).
See full target information PQBP1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com