JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152234

Recombinant Human PRDM1/Blimp1 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human PRDM1/Blimp1 protein (GST tag N-Terminus) is a Human Fragment protein, in the 1 to 109 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

BLIMP1, PRDM1, PR domain zinc finger protein 1, BLIMP-1, Beta-interferon gene positive regulatory domain I-binding factor, PR domain-containing protein 1, Positive regulatory domain I-binding factor 1, PRDI-BF1, PRDI-binding factor 1

1 Images
SDS-PAGE - Recombinant Human PRDM1/Blimp1 protein (GST tag N-Terminus) (AB152234)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human PRDM1/Blimp1 protein (GST tag N-Terminus) (AB152234)

12.5% SDS-PAGE analysis of ab152234 stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA, SDS-PAGE

applications

Biologically active

No

Accession

O75626

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELH","proteinLength":"Fragment","predictedMolecularWeight":"37.73 kDa","actualMolecularWeight":null,"aminoAcidEnd":109,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"O75626","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

PRDM1 also referred to as Blimp-1 is a transcription factor involved in the regulation of gene expression. It has a molecular mass of approximately 106 kDa. This protein is expressed in a variety of cell types including B lymphocytes T cells and in certain tissues such as the intestine. It plays an important role in controlling the transcriptional programs necessary for cellular differentiation and development. PRDM1 functions mainly by binding to specific DNA sequences to repress the transcription of target genes acting as a master regulator in the immune system.
Biological function summary

PRDM1/Blimp-1 influences important processes like plasma cell differentiation particularly in the immune response. It is not part of a larger protein complex but functions by recruiting chromatin-modifying enzymes to silence target gene expression. In B cells it promotes the transition to plasma cell formation by repressing genes that would otherwise inhibit this differentiation. Blimp1 also plays a role in maintaining the differentiation state by regulating genes involved in cell survival and function.

Pathways

PRDM1/Blimp1 is primarily associated with pathways such as the B cell maturation and immunoglobulin secretion pathways. It acts downstream of signaling cascades initiated by factors like CD40 and IL-21. PRDM1 works closely with other transcription factors like XBP-1 in the pathway to drive effective plasma cell differentiation. By repressing factors such as Pax5 and Bcl6 PRDM1 ensures the proper execution of the differentiation program within these pathways.

Malfunctions in PRDM1/Blimp1 are linked to autoimmune conditions like systemic lupus erythematosus and some types of lymphomas. Altered function or expression can disrupt immune homeostasis leading to the production of autoantibodies. Disorders may arise when PRDM1 fails to repress genes like those regulated by Bcl6 contributing to unregulated cell growth and abnormal immune activity. Additionally its dysfunction can be observed in certain gastrointestinal disorders where it is pivotal for maintaining gut immune homeostasis.

Specifications

Form

Liquid

General info

Function

Transcription factor that mediates a transcriptional program in various innate and adaptive immune tissue-resident lymphocyte T cell types such as tissue-resident memory T (Trm), natural killer (trNK) and natural killer T (NKT) cells and negatively regulates gene expression of proteins that promote the egress of tissue-resident T-cell populations from non-lymphoid organs. Plays a role in the development, retention and long-term establishment of adaptive and innate tissue-resident lymphocyte T cell types in non-lymphoid organs, such as the skin and gut, but also in other nonbarrier tissues like liver and kidney, and therefore may provide immediate immunological protection against reactivating infections or viral reinfection (By similarity). Binds specifically to the PRDI element in the promoter of the beta-interferon gene (PubMed : 1851123). Drives the maturation of B-lymphocytes into Ig secreting cells (PubMed : 12626569). Associates with the transcriptional repressor ZNF683 to chromatin at gene promoter regions (By similarity). Binds to the promoter and acts as a transcriptional repressor of IRF8, thereby promotes transcription of osteoclast differentiation factors such as NFATC1 and EEIG1 (By similarity).

Sequence similarities

Belongs to the class V-like SAM-binding methyltransferase superfamily.

Post-translational modifications

Sumoylation at Lys-816 by PIAS1 augments transcriptional repressor activity, and is critical for plasma cell differentiation (PubMed:22555612). Can be sumoylated with SUMO1 and SUMO2 by PML. Degradation of the wild-type protein mostly depends upon sumoylation, rather than ubiquitination (PubMed:28842558). Desumoylated by SENP1 and SENP6 (PubMed:28842558).. Ubiquitinated by the SCF(FBXO11) complex, leading to its degradation by the proteasome.

Subcellular localisation

Nucleus

Product protocols

Target data

Transcription factor that mediates a transcriptional program in various innate and adaptive immune tissue-resident lymphocyte T cell types such as tissue-resident memory T (Trm), natural killer (trNK) and natural killer T (NKT) cells and negatively regulates gene expression of proteins that promote the egress of tissue-resident T-cell populations from non-lymphoid organs. Plays a role in the development, retention and long-term establishment of adaptive and innate tissue-resident lymphocyte T cell types in non-lymphoid organs, such as the skin and gut, but also in other nonbarrier tissues like liver and kidney, and therefore may provide immediate immunological protection against reactivating infections or viral reinfection (By similarity). Binds specifically to the PRDI element in the promoter of the beta-interferon gene (PubMed : 1851123). Drives the maturation of B-lymphocytes into Ig secreting cells (PubMed : 12626569). Associates with the transcriptional repressor ZNF683 to chromatin at gene promoter regions (By similarity). Binds to the promoter and acts as a transcriptional repressor of IRF8, thereby promotes transcription of osteoclast differentiation factors such as NFATC1 and EEIG1 (By similarity).
See full target information PRDM1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com