JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB159105

Recombinant Human Progesterone Receptor protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Progesterone Receptor protein (GST tag N-Terminus) is a Human Fragment protein, in the 1 to 110 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

NR3C3, PGR, Progesterone receptor, PR, Nuclear receptor subfamily 3 group C member 3

1 Images
SDS-PAGE - Recombinant Human Progesterone Receptor protein (GST tag N-Terminus) (AB159105)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Progesterone Receptor protein (GST tag N-Terminus) (AB159105)

ab159105 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

P06401

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGL","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":110,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P06401","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The progesterone receptor (PR) also known as NR3C3 is a nuclear receptor that functions as a transcription factor in response to the hormone progesterone. This receptor has a mass of approximately 99 kDa and is expressed in tissues such as the reproductive organs including the uterus ovaries and mammary glands. It is also found in non-reproductive tissues like the brain and bone. The receptor has two main isoforms PR-A and PR-B which differ slightly in structure but have unique biological roles.
Biological function summary

The progesterone receptor plays a significant role in regulating gene expression related to reproductive processes. PR is not part of a larger complex by itself but interacts with various coactivators and corepressors to modulate transcription. In the uterus and mammary glands PR mediates the effects of progesterone by promoting cell proliferation and preparing tissues for pregnancy. In other systems PR also links to various metabolic and immunological pathways influencing cell cycle progression and immune response.

Pathways

Progesterone receptor activity is integrated within the reproductive hormone signaling pathways and the Wnt signaling pathway. The receptor interacts directly with key proteins such as estrogen receptor (ER) and steroid receptor coactivator (SRC) complexes which are pivotal in modulating response to hormonal signals. These interactions underline the essential role of PR in maintaining hormonal balance and regulating reproductive functions.

The progesterone receptor associates with breast cancer and endometriosis. Aberrant expression or mutations in PR can contribute to the development and progression of breast cancer often linked with the estrogen receptor's influence. In endometriosis PR's altered functionality affects cellular response to progesterone contributing to tissue growth outside the uterus. These conditions also involve interactions with proteins like BRCA1 in breast cancer highlighting how PR connects to broader cellular and pathological networks.

Specifications

Form

Liquid

General info

Function

The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Depending on the isoform, progesterone receptor functions as a transcriptional activator or repressor.. Isoform A. Ligand-dependent transdominant repressor of steroid hormone receptor transcriptional activity including repression of its isoform B, MR and ER. Transrepressional activity may involve recruitment of corepressor NCOR2.. Isoform B. Transcriptional activator of several progesteron-dependent promoters in a variety of cell types. Involved in activation of SRC-dependent MAPK signaling on hormone stimulation.. Isoform 4. Increases mitochondrial membrane potential and cellular respiration upon stimulation by progesterone.

Sequence similarities

Belongs to the nuclear hormone receptor family. NR3 subfamily.

Post-translational modifications

Phosphorylated on multiple serine sites. Several of these sites are hormone-dependent. Phosphorylation on Ser-294 occurs preferentially on isoform B, is highly hormone-dependent and modulates ubiquitination and sumoylation on Lys-388. Phosphorylation on Ser-102 and Ser-345 also requires induction by hormone. Basal phosphorylation on Ser-81, Ser-162, Ser-190 and Ser-400 is increased in response to progesterone and can be phosphorylated in vitro by the CDK2-A1 complex. Increased levels of phosphorylation on Ser-400 also in the presence of EGF, heregulin, IGF, PMA and FBS. Phosphorylation at this site by CDK2 is ligand-independent, and increases nuclear translocation and transcriptional activity. Phosphorylation at Ser-162 and Ser-294, but not at Ser-190, is impaired during the G(2)/M phase of the cell cycle. Phosphorylation on Ser-345 by ERK1/2 MAPK is required for interaction with SP1.. Sumoylation is hormone-dependent and represses transcriptional activity. Sumoylation on all three sites is enhanced by PIAS3. Desumoylated by SENP1. Sumoylation on Lys-388, the main site of sumoylation, is repressed by ubiquitination on the same site, and modulated by phosphorylation at Ser-294.. Ubiquitination is hormone-dependent and represses sumoylation on the same site (PubMed:10628747, PubMed:10655479, PubMed:15798179, PubMed:17173941, PubMed:17717077, PubMed:18202149, PubMed:8702648). Promoted by MAPK-mediated phosphorylation on Ser-294 (PubMed:10628747, PubMed:10655479, PubMed:15798179, PubMed:17173941, PubMed:17717077, PubMed:18202149, PubMed:8702648). Ubiquitinated by UBR5, leading to its degradation: UBR5 specifically recognizes and binds ligand-bound PGR when it is not associated with coactivators (NCOAs) (PubMed:37478846). In presence of NCOAs, the UBR5-degron is not accessible, preventing its ubiquitination and degradation (PubMed:37478846).. Palmitoylated by ZDHHC7 and ZDHHC21. Palmitoylation is required for plasma membrane targeting and for rapid intracellular signaling via ERK and AKT kinases and cAMP generation.

Subcellular localisation

Mitochondrion outer membrane

Product protocols

Target data

The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Depending on the isoform, progesterone receptor functions as a transcriptional activator or repressor.. Isoform A. Ligand-dependent transdominant repressor of steroid hormone receptor transcriptional activity including repression of its isoform B, MR and ER. Transrepressional activity may involve recruitment of corepressor NCOR2.. Isoform B. Transcriptional activator of several progesteron-dependent promoters in a variety of cell types. Involved in activation of SRC-dependent MAPK signaling on hormone stimulation.. Isoform 4. Increases mitochondrial membrane potential and cellular respiration upon stimulation by progesterone.
See full target information PGR

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com