JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB117227

Recombinant Human Proteasome 20S beta 3 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Proteasome 20S beta 3 protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 246 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Proteasome subunit beta type-3, Proteasome chain 13, Proteasome component C10-II, Proteasome subunit beta-3, Proteasome theta chain, beta-3, PSMB3

2 Images
SDS-PAGE - Recombinant Human Proteasome 20S beta 3 protein (His tag N-Terminus) (AB117227)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Proteasome 20S beta 3 protein (His tag N-Terminus) (AB117227)

SDS-PAGE analysis of ab117227 (3µg).

SDS-PAGE - Recombinant Human Proteasome 20S beta 3 protein (His tag N-Terminus) (AB117227)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Proteasome 20S beta 3 protein (His tag N-Terminus) (AB117227)

15% SDS-PAGE showing ab117227 at approximately 25.1kDa (3μg).

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

P49720

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 50% Glycerol (glycerin, glycerine), 1.17% Sodium chloride, 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD","proteinLength":"Full Length","predictedMolecularWeight":"25.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":246,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P49720","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Proteasome 20S beta 3 also known as PSMB3 is a structural component of the proteasome complex a multicatalytic proteinase complex with a role in degradation of ubiquitinated proteins. It has a molecular mass of approximately 25 kDa. The 20S proteasome functions in the cytoplasm and nucleus expressed in all eukaryotic cells. It participates in protein homeostasis by breaking down short-lived and damaged proteins into peptides important for cellular regulation.
Biological function summary

Proteasome 20S beta 3 contributes to the assembly and function of the 26S proteasome complex. This complex facilitates the regulated degradation of intracellular proteins a process critical for various cellular processes including the cell cycle apoptosis and DNA repair. Proteasome 20S beta 3 is one of the 14 different subunits that make up the beta rings of the 20S core particle engaging in precise proteolytic activity within cells.

Pathways

Proteasome 20S beta 3 is essential in the ubiquitin-proteasome pathway a major pathway for protein catabolism. This pathway maintains protein equilibrium and modulates proteins involved in immune response and signal transduction. It closely interacts with ubiquitin ligases which tag proteins for degradation and connects to key pathways like the NF-kB signaling pathway where it can influence inflammatory responses due to its role in processing specific intracellular proteins.

Proteasome 20S beta 3's dysregulation links to cancer and neurodegenerative diseases due to its role in protein degradation. In cancer altered proteasome function can result in the accumulation of oncoproteins or degradation of tumor suppressor proteins. Also disrupted protein homeostasis contributes to neurodegenerative disorders such as Alzheimer's disease where pathogenesis often involves proteasome impairment. Its interactions with proteins like the tumor suppressor p53 highlight its significance in maintaining cellular health and prevent disease progression.

Specifications

Form

Liquid

Additional notes

ab117227 is purified using conventional chromatography techniques.

General info

Function

Non-catalytic component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex).

Sequence similarities

Belongs to the peptidase T1B family.

Subcellular localisation

Nucleus

Product protocols

Target data

Non-catalytic component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex).
See full target information PSMB3

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com