JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB105592

Recombinant Human Proteasome 20S LMP2 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Proteasome 20S LMP2 protein is a Human Full Length protein, in the 21 to 219 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

LMP2, PSMB6i, RING12, PSMB9, Proteasome subunit beta type-9, Low molecular mass protein 2, Macropain chain 7, Multicatalytic endopeptidase complex chain 7, Proteasome chain 7, Proteasome subunit beta-1i, Really interesting new gene 12 protein

1 Images
SDS-PAGE - Recombinant Human Proteasome 20S LMP2 protein (AB105592)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Proteasome 20S LMP2 protein (AB105592)

SDS-PAGE analysis of 3µg ab105592 under reducing condition and visualized by coomassie blue stain.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

P28065

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.316% Tris HCl, 0.29% Sodium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE","proteinLength":"Full Length","predictedMolecularWeight":"23.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":219,"aminoAcidStart":21,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P28065","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The proteasome LMP2 also known as proteasome subunit beta type-1 or PSMB9 is a component important in the functioning of the 20S proteasome complex. This molecular entity with a mass of approximately 23 kDa is predominantly expressed in immune cells including lymphocytes. LMP2 incorporates into the immunoproteasome a specialized variant of the proteasome that participates prominently in the processing of class I MHC peptides enhancing the immune response.
Biological function summary

LMP2 is integral to protein catabolism and regulation of the cellular protein homeostasis. As part of the larger proteasome complex the LMP2 protein functions in degradative pathways that recycle amino acids from ubiquitin-tagged proteins. This proteasome takes part in antigen processing helping convert proteins into peptides that are presented on the surface of cells for immune system recognition.

Pathways

LMP2 is significantly involved in the ubiquitin-proteasome pathway and immune system processes. It interacts with other immunoproteasome subunits like LMP7 and MECL-1 which work together to enhance the proteolytic capacity for antigen presentation. The presence of LMP2 in these pathways demonstrates its role in adaptive immunity contributing to the clearance of misfolded or damaged proteins and therefore maintaining cell health.

LMP2 associates with immune-related conditions and some cancer types. Dysregulation of LMP2 expression or function can impact antigen presentation potentially leading to autoimmune disorders due to inappropriate immune activation. Moreover alterations in LMP2 expression have been observed in certain cancers such as melanoma where it affects proteasome activity and influences tumor progression. In these contexts interactions with proteins like TAP1 and TAP2 which aid in peptide transport mark its relevance in disease pathogenesis.

Specifications

Form

Liquid

Additional notes

ab105592 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.

General info

Function

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH (PubMed : 33727065, PubMed : 34819510). The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides. Replacement of PSMB6 by PSMB9 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues.

Sequence similarities

Belongs to the peptidase T1B family.

Post-translational modifications

Autocleaved. The resulting N-terminal Thr residue of the mature subunit is responsible for the nucleophile proteolytic activity.

Subcellular localisation

Nucleus

Product protocols

Target data

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH (PubMed : 33727065, PubMed : 34819510). The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides. Replacement of PSMB6 by PSMB9 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues.
See full target information PSMB9

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com