JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB236180

Recombinant Human Proteasome 20S LMP7 protein (Tagged)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Proteasome 20S LMP7 protein (Tagged) is a Human Full Length protein, in the 73 to 276 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE.

View Alternative Names

LMP7, PSMB5i, RING10, Y2, PSMB8, Proteasome subunit beta type-8, Low molecular mass protein 7, Macropain subunit C13, Multicatalytic endopeptidase complex subunit C13, Proteasome component C13, Proteasome subunit beta-5i, Really interesting new gene 10 protein

1 Images
SDS-PAGE - Recombinant Human Proteasome 20S LMP7 protein (Tagged) (AB236180)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Proteasome 20S LMP7 protein (Tagged) (AB236180)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab236180.

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

10x His tag N-Terminus SUMO tag N-Terminus Myc tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P28062

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"TTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ","proteinLength":"Full Length","predictedMolecularWeight":"42.7 kDa","actualMolecularWeight":null,"aminoAcidEnd":276,"aminoAcidStart":73,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P28062","tags":[{"tag":"10x His","terminus":"N-Terminus"},{"tag":"SUMO","terminus":"N-Terminus"},{"tag":"Myc","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Proteasome 20S LMP7 also known as β5i or PSMB8 is a subunit of the immunoproteasome. It weighs about 23 kDa and it is expressed predominantly in immune cells such as lymphocytes and macrophages. LMP7 is part of the proteasome 20S a cylindrical core particle involved in the degradation of ubiquitinated proteins. This process helps maintain protein homeostasis by breaking down misfolded and damaged proteins.
Biological function summary

The immunoproteasome in which LMP7 is an essential component plays an important role in the adaptive immune system. It influences the generation of antigenic peptides that are presented on MHC class I molecules. LMP7's expression is increased during immune responses particularly following gamma interferon (IFN-γ) stimulation contributing to the immune-mediated proteasome conformation. The immunoproteasome enables more efficient peptide processing enhancing antigen presentation to cytotoxic T lymphocytes.

Pathways

LMP7 is involved in the MHC class I antigen presentation pathway. This pathway allows the immune system to detect and respond to intracellular pathogens such as viruses. Additionally LMP7 interacts with TAP (Transporter associated with Antigen Processing) and other proteasome subunits to ensure effective peptide processing for loading onto MHC class I molecules. Through this involvement it closely links to immune signaling and cellular stress responses.

Research shows that LMP7 connects to autoimmune diseases and inflammatory disorders such as lupus and rheumatoid arthritis. Dysregulation of LMP7 expression or activity can lead to improper immune responses contributing to disease pathogenesis. Furthermore LMP7 impacts the degradation of specific proteins relevant to these conditions. For example it works alongside other proteasome subunits like LMP2 and MECL-1 in modulating the inflammatory response which can exacerbate autoimmune disease symptoms.

Specifications

Form

Liquid

General info

Function

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides. Replacement of PSMB5 by PSMB8 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues. Involved in the generation of spliced peptides resulting from the ligation of two separate proteasomal cleavage products that are not contiguous in the parental protein (PubMed : 27049119). Acts as a major component of interferon gamma-induced sensitivity. Plays a key role in apoptosis via the degradation of the apoptotic inhibitor MCL1. May be involved in the inflammatory response pathway. In cancer cells, substitution of isoform 1 (E2) by isoform 2 (E1) results in immunoproteasome deficiency. Required for the differentiation of preadipocytes into adipocytes.

Sequence similarities

Belongs to the peptidase T1B family.

Post-translational modifications

Autocleaved. The resulting N-terminal Thr residue of the mature subunit is responsible for the nucleophile proteolytic activity.

Subcellular localisation

Nucleus

Product protocols

Target data

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides. Replacement of PSMB5 by PSMB8 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues. Involved in the generation of spliced peptides resulting from the ligation of two separate proteasomal cleavage products that are not contiguous in the parental protein (PubMed : 27049119). Acts as a major component of interferon gamma-induced sensitivity. Plays a key role in apoptosis via the degradation of the apoptotic inhibitor MCL1. May be involved in the inflammatory response pathway. In cancer cells, substitution of isoform 1 (E2) by isoform 2 (E1) results in immunoproteasome deficiency. Required for the differentiation of preadipocytes into adipocytes.
See full target information PSMB8

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com