JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB116169

Recombinant Human Proteasome subunit beta type 2/PSMB2 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Proteasome subunit beta type 2/PSMB2 protein is a Human Full Length protein, in the 1 to 201 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Proteasome subunit beta type-2, Macropain subunit C7-I, Multicatalytic endopeptidase complex subunit C7-I, Proteasome component C7-I, Proteasome subunit beta-4, beta-4, PSMB2

1 Images
SDS-PAGE - Recombinant Human Proteasome subunit beta type 2/PSMB2 protein (AB116169)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Proteasome subunit beta type 2/PSMB2 protein (AB116169)

15% SDS-PAGE showing ab116169 at approximately 24.9 kDa (3µg).

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

P49721

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 30% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as PSMB2, Proteasome subunit beta type 2

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS","proteinLength":"Full Length","predictedMolecularWeight":"24.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":201,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P49721","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Proteasome subunit beta type 2 also known as PSMB2 is a part of the proteasome complex which plays an important role in protein degradation. PSMB2 has a mass of about 22 kDa and functions within the multi-catalytic proteinase complex known as the 20S proteasome core particle. This protein is expressed in various tissues with significant activities found in cells that demand high protein turnover. PSMB2 contributes to the proteasome's chymotrypsin-like activity aiding in the breakdown of damaged or unneeded proteins into peptides.
Biological function summary

Proteasome subunit beta type 2 is essential in maintaining protein homeostasis. It functions as a component of the 20S core of the 26S proteasome where it participates in degrading ubiquitin-tagged proteins. This complex also regulates multiple cellular processes including cell cycle progression and signal transduction. Proper function of PSMB2 is necessary for removing misfolded or damaged proteins thereby preventing their accumulation which could be toxic to cells.

Pathways

Proteasome subunit beta type 2 has a role in the ubiquitin-proteasome pathway which is important for protein degradation and turnover. This pathway contributes to important cellular processes such as DNA repair and antigen processing. PSMB2 in this context is linked to other proteins like ubiquitin-ligase that mediate the tagging of proteins for degradation. Another pathway involving PSMB2 is the NF-kB signaling pathway which controls inflammatory responses and immune system regulation.

Proteasome subunit beta type 2 has been implicated in neurodegenerative diseases like Parkinson’s. The dysregulation or malfunctioning of the proteasome complex might result in protein aggregation seen in such disorders. Additionally PSMB2 is associated with certain cancers due to its role in regulating apoptosis and cellular proliferative activities. Proteins like p53 which is important for tumor suppression are related to PSMB2 through these disease mechanisms highlighting its significance in maintaining normal cellular function and preventing disease progression.

Specifications

Form

Liquid

Additional notes

ab116169 is purified using conventional chromatography techniques.

General info

Function

Non-catalytic component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex).

Sequence similarities

Belongs to the peptidase T1B family.

Subcellular localisation

Nucleus

Product protocols

Target data

Non-catalytic component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex).
See full target information PSMB2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com