JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB123208

Recombinant Human Proteasome subunit beta type-7 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Proteasome subunit beta type-7 protein is a Human Full Length protein, in the 44 to 277 aa range, expressed in Escherichia coli, with >80%, suitable for Mass Spec, SDS-PAGE.

View Alternative Names

Z, PSMB7, Proteasome subunit beta type-7, Macropain chain Z, Multicatalytic endopeptidase complex chain Z, Proteasome subunit Z, Proteasome subunit beta-2, beta-2

Key facts

Purity

>80% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Q99436

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>Molecular size on SDS-PAGE will appear higher</p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS","proteinLength":"Full Length","predictedMolecularWeight":"27.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":277,"aminoAcidStart":44,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q99436","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Proteasome subunit beta type-7 also known as PSB7 or PSMB7 is an essential component of the 20S core proteasome complex. It has a molecular weight of approximately 27 kDa. This protein is expressed ubiquitously in human tissues indicating its broad role in cellular functions. As a catalytic subunit PSB7 contributes to the proteolytic core of the proteasome which is responsible for degrading ubiquitinated proteins through ATP-dependent proteolysis.
Biological function summary

PSB7 forms part of the larger 26S proteasome complex that plays a significant role in maintaining cellular protein homeostasis. The complex is vital for degrading misfolded damaged or short-lived regulatory proteins. The degradation process by the proteasome prevents the accumulation of defective proteins which can be harmful. PSB7 along with other beta subunits contributes to the protease activity within the central chamber of the proteasome ensuring proper peptide cleavage.

Pathways

PSB7's involvement is key to the ubiquitin-proteasome pathway an essential cellular process for protein turnover. This pathway regulates various cellular processes including cell cycle apoptosis and responses to oxidative stress. PSB7 through the proteasome interacts with proteins like ubiquitin ligases and deubiquitinating enzymes which attach or remove ubiquitin tags from substrate proteins. Additionally PSB7 is linked to the NF-kB signaling pathway where it participates in the degradation of inhibitors that regulate NF-kB activity.

PSB7 plays a significant role in multiple myeloma and various types of cancer. Dysregulation of the proteasome activity with changed expression or function of PSB7 can lead to uncontrolled cell proliferation and tumor development. It also finds relevance in neurodegenerative diseases such as Alzheimer's disease where proteasome dysfunction can cause improper protein clearance and aggregation. In these diseases proteins like tau in Alzheimer's are substrates for the proteasome degradation pathway involving PSB7.

Specifications

Form

Liquid

Additional notes

ab123208 is purified by using conventional chromatography. Purity is > 80% by SDS-PAGE.

General info

Function

Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex). Within the 20S core complex, PSMB7 displays a trypsin-like activity.

Sequence similarities

Belongs to the peptidase T1B family.

Subcellular localisation

Nucleus

Product protocols

Target data

Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex). Within the 20S core complex, PSMB7 displays a trypsin-like activity.
See full target information PSMB7

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com