JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB115721

Recombinant Human PSMB4 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human PSMB4 protein is a Human Full Length protein, in the 46 to 264 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

PROS26, PSMB4, Proteasome subunit beta type-4, 26 kDa prosomal protein, Macropain beta chain, Multicatalytic endopeptidase complex beta chain, Proteasome beta chain, Proteasome chain 3, Proteasome subunit beta-7, HsBPROS26, PROS-26, HsN3, beta-7

1 Images
SDS-PAGE - Recombinant Human PSMB4 protein (AB115721)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human PSMB4 protein (AB115721)

15% SDS-PAGE showing ab115721 at approximately 26.6kDa (3μg).

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

P28070

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 30% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as Proteasome subunit beta type 4

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMTQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE","proteinLength":"Full Length","predictedMolecularWeight":"26.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":264,"aminoAcidStart":46,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P28070","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

PSMB4 also known as proteasome subunit beta type-4 is a critical component of the 20S proteasome complex involved in protein degradation. Its molecular mass is approximately 29 kDa. PSMB4 expression occurs widely including in the cytoplasm and nucleus of eukaryotic cells. It plays an important role in regulating protein turnover by participating in the breakdown of ubiquitinated proteins essential for maintaining cellular protein homeostasis.
Biological function summary

The 20S proteasome where PSMB4 belongs acts as the proteolytic core of the 26S proteasome complex. This complex degrades unwanted or damaged proteins thereby regulating various cellular processes such as the cell cycle apoptosis and DNA repair. PSMB4's activity ensures the removal of potentially toxic proteins which is important for cell function and survival.

Pathways

PSMB4 is involved in key pathways such as the ubiquitin-proteasome pathway and antigen processing. These pathways regulate protein metabolism and assist in immune surveillance by presenting endogenous antigens through MHC class I molecules. PSMB4 interacts closely with other proteasome subunits like PSMB5 and PSMB6 which coordinate to cleave peptide bonds in substrate proteins effectively.

Mutations or dysregulation of PSMB4 link to multiple myeloma and neurodegenerative diseases. In multiple myeloma changes in PSMB4 may affect proteasome inhibitor effectiveness while in neurodegenerative disorders impaired protein degradation can lead to protein aggregation. PSMB4 has potential interactions with proteins such as ubiquitin and PSMC3 which further influence disease progression.

Specifications

Form

Liquid

Additional notes

ab115721 was purified using conventional chromatography techniques.

General info

Function

Non-catalytic component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex). SMAD1/OAZ1/PSMB4 complex mediates the degradation of the CREBBP/EP300 repressor SNIP1.

Sequence similarities

Belongs to the peptidase T1B family.

Subcellular localisation

Nucleus

Product protocols

Target data

Non-catalytic component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex). SMAD1/OAZ1/PSMB4 complex mediates the degradation of the CREBBP/EP300 repressor SNIP1.
See full target information PSMB4

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com