JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB256097

Recombinant Human PTN protein (Animal Free)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human PTN protein (Animal Free) is a Human Full Length protein, in the 33 to 168 aa range, expressed in Escherichia coli, with >95%, <1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

HBNF1, NEGF1, PTN, Pleiotrophin, Heparin-binding brain mitogen, Heparin-binding growth factor 8, Heparin-binding growth-associated molecule, Heparin-binding neurite outgrowth-promoting factor, Heparin-binding neurite outgrowth-promoting factor 1, Osteoblast-specific factor 1, HBBM, HBGF-8, HB-GAM, HBNF, HBNF-1, OSF-1

1 Images
SDS-PAGE - Recombinant Human PTN protein (Animal Free) (AB256097)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human PTN protein (Animal Free) (AB256097)

SDS-PAGE analysis of ab256097 (1 μg) under reducing (Lane 1) and non-reducing (Lane 2) conditions.

4-20% Tris-Glycine gel. Coomassie Blue staining.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

<1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P21246

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute at 0.1 mg/mL in water

Storage buffer

Constituents: 0.16% Sodium phosphate

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD","proteinLength":"Full Length","predictedMolecularWeight":"15.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":168,"aminoAcidStart":33,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P21246","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Pleiotrophin also known as PTN Ptn or $Ptn is a heparin-binding growth factor with a molecular mass of approximately 18 kDa. It is expressed in various tissues notably in the brain during embryonic development and also in adulthood. PTN plays a fundamental role in cellular proliferation differentiation and survival. As a secreted protein it interacts with cell surface receptors to trigger intracellular signaling pathways.
Biological function summary

Pleiotrophin functions as a potent mitogen promoting cell growth and angiogenesis. It does not operate as part of a larger protein complex but acts independently to influence cellular behavior. Its interaction with receptor protein tyrosine phosphatase (RPTP) modulates the tyrosine phosphorylation state of other proteins affecting downstream signaling. This interaction facilitates communication between cells and their environments influencing development and tissue maintenance.

Pathways

This protein significantly impacts the PI3K/Akt and MAPK/ERK pathways key regulators of cell survival and proliferation. PTN often collaborates with proteins like Midkine (MK) due to their functional similarities and overlapping receptor targets. These pathways help regulate cellular responses to environmental cues contributing to processes such as tissue repair and regeneration.

The overexpression of pleiotrophin has been linked to the development of cancers such as breast cancer and glioblastoma. PTN's interaction with oncogenic pathways often involving proteins like N-cadherin enhances its relevance in tumor progression and metastasis. Additionally alterations in PTN expression or activity can influence neural disorders highlighting its importance in both oncological and neurological contexts.

Specifications

Form

Lyophilized

General info

Function

Secreted growth factor that mediates its signal through cell-surface proteoglycan and non-proteoglycan receptors (PubMed : 11278720, PubMed : 16814777, PubMed : 19141530). Binds cell-surface proteoglycan receptor via their chondroitin sulfate (CS) groups (PubMed : 26896299, PubMed : 27445335). Thereby regulates many processes like cell proliferation, cell survival, cell growth, cell differentiation and cell migration in several tissues namely neuron and bone (PubMed : 11278720, PubMed : 1733956, PubMed : 1768439, PubMed : 19141530, PubMed : 19442624, PubMed : 27445335, PubMed : 30667096). Also plays a role in synaptic plasticity and learning-related behavior by inhibiting long-term synaptic potentiation (By similarity). Binds PTPRZ1, leading to neutralization of the negative charges of the CS chains of PTPRZ1, inducing PTPRZ1 clustering, thereby causing the dimerization and inactivation of its phosphatase activity leading to increased tyrosine phosphorylation of each of the PTPRZ1 substrates like ALK, CTNNB1 or AFAP1L2 in order to activate the PI3K-AKT pathway (PubMed : 10706604, PubMed : 16814777, PubMed : 17681947, PubMed : 27445335, PubMed : 30667096). Through PTPRZ1 binding controls oligodendrocyte precursor cell differentiation by enhancing the phosphorylation of AFAP1L2 in order to activate the PI3K-AKT pathway (PubMed : 27445335, PubMed : 30667096). Forms a complex with PTPRZ1 and integrin alpha-V/beta-3 (ITGAV : ITGB3) that stimulates endothelial cell migration through SRC dephosphorylation and activation that consequently leads to ITGB3 'Tyr-773' phosphorylation (PubMed : 19141530). In adult hippocampus promotes dendritic arborization, spine development, and functional integration and connectivity of newborn granule neurons through ALK by activating AKT signaling pathway (By similarity). Binds GPC2 and chondroitin sulfate proteoglycans (CSPGs) at the neuron surface, leading to abrogation of binding between PTPRS and CSPGs and neurite outgrowth promotion (By similarity). Binds SDC3 and mediates bone formation by recruiting and attaching osteoblasts/osteoblast precursors to the sites for new bone deposition (By similarity). Binds ALK and promotes cell survival and cell proliferation through MAPK pathway activation (PubMed : 11278720). Inhibits proliferation and enhances differentiation of neural stem cells by inhibiting FGF2-induced fibroblast growth factor receptor signaling pathway (By similarity). Mediates regulatory mechanisms in normal hemostasis and in hematopoietic regeneration and in maintaining the balance of myeloid and lymphoid regeneration (By similarity). In addition may play a role in the female reproductive system, auditory response and the progesterone-induced decidualization pathway (By similarity).

Sequence similarities

Belongs to the pleiotrophin family.

Post-translational modifications

Phosphorylated by NEK6.

Product protocols

Target data

Secreted growth factor that mediates its signal through cell-surface proteoglycan and non-proteoglycan receptors (PubMed : 11278720, PubMed : 16814777, PubMed : 19141530). Binds cell-surface proteoglycan receptor via their chondroitin sulfate (CS) groups (PubMed : 26896299, PubMed : 27445335). Thereby regulates many processes like cell proliferation, cell survival, cell growth, cell differentiation and cell migration in several tissues namely neuron and bone (PubMed : 11278720, PubMed : 1733956, PubMed : 1768439, PubMed : 19141530, PubMed : 19442624, PubMed : 27445335, PubMed : 30667096). Also plays a role in synaptic plasticity and learning-related behavior by inhibiting long-term synaptic potentiation (By similarity). Binds PTPRZ1, leading to neutralization of the negative charges of the CS chains of PTPRZ1, inducing PTPRZ1 clustering, thereby causing the dimerization and inactivation of its phosphatase activity leading to increased tyrosine phosphorylation of each of the PTPRZ1 substrates like ALK, CTNNB1 or AFAP1L2 in order to activate the PI3K-AKT pathway (PubMed : 10706604, PubMed : 16814777, PubMed : 17681947, PubMed : 27445335, PubMed : 30667096). Through PTPRZ1 binding controls oligodendrocyte precursor cell differentiation by enhancing the phosphorylation of AFAP1L2 in order to activate the PI3K-AKT pathway (PubMed : 27445335, PubMed : 30667096). Forms a complex with PTPRZ1 and integrin alpha-V/beta-3 (ITGAV : ITGB3) that stimulates endothelial cell migration through SRC dephosphorylation and activation that consequently leads to ITGB3 'Tyr-773' phosphorylation (PubMed : 19141530). In adult hippocampus promotes dendritic arborization, spine development, and functional integration and connectivity of newborn granule neurons through ALK by activating AKT signaling pathway (By similarity). Binds GPC2 and chondroitin sulfate proteoglycans (CSPGs) at the neuron surface, leading to abrogation of binding between PTPRS and CSPGs and neurite outgrowth promotion (By similarity). Binds SDC3 and mediates bone formation by recruiting and attaching osteoblasts/osteoblast precursors to the sites for new bone deposition (By similarity). Binds ALK and promotes cell survival and cell proliferation through MAPK pathway activation (PubMed : 11278720). Inhibits proliferation and enhances differentiation of neural stem cells by inhibiting FGF2-induced fibroblast growth factor receptor signaling pathway (By similarity). Mediates regulatory mechanisms in normal hemostasis and in hematopoietic regeneration and in maintaining the balance of myeloid and lymphoid regeneration (By similarity). In addition may play a role in the female reproductive system, auditory response and the progesterone-induced decidualization pathway (By similarity).
See full target information PTN

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com