JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB132055

Recombinant Human PTPN22 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human PTPN22 protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 179 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

PTPN8, PTPN22, Tyrosine-protein phosphatase non-receptor type 22, Hematopoietic cell protein-tyrosine phosphatase 70Z-PEP, Lymphoid phosphatase, PEST-domain phosphatase, LyP, PEP

1 Images
SDS-PAGE - Recombinant Human PTPN22 protein (GST tag N-Terminus) (AB132055)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human PTPN22 protein (GST tag N-Terminus) (AB132055)

12.5% SDS-PAGE analysis of ab132055 stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

SDS-PAGE, WB, ELISA

applications

Biologically active

No

Accession

Q9Y2R2

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEYSVLIIVMACMEYEMGKEAEKRKSDYIIRTLKVKFNSVSVILAHQTSLQNLFSQITPAHF","proteinLength":"Full Length","predictedMolecularWeight":"45.43 kDa","actualMolecularWeight":null,"aminoAcidEnd":179,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q9Y2R2","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Protein tyrosine phosphatase non-receptor type 22 (PTPN22) also known as Lyp is a phosphatase enzyme with a molecular mass of approximately 98 kDa. It removes phosphate groups from specific proteins participating in the regulation of signaling pathways that control cellular processes. PTPN22 is expressed in lymphoid tissues including T-cells B-cells and other immune cells. This distribution indicates its role in immune system function and signaling.
Biological function summary

PTPN22 plays a role in modulating immune responses impacting the activation of T-cells and B-cells. By altering signal transduction pathways it affects the threshold for immune cell activation. PTPN22 interacts with other signaling molecules but it is not known to be a part of any well-described protein complex. Its activity influences immune tolerance and autoimmunity making it an important player in maintaining immune system balance.

Pathways

PTPN22 is involved in the T-cell receptor signaling and negative regulation pathways. It dephosphorylates lymphocyte-specific protein tyrosine kinase (LCK) and ZAP-70 which are pivotal in T-cell activation. By regulating such proteins PTPN22 plays a direct role in modulating T-cell responses. The signaling balance achieved through its actions prevents overactive immune responses that could lead to autoimmune conditions.

PTPN22 has strong connections to autoimmune diseases such as rheumatoid arthritis and type 1 diabetes. Variants in the PTPN22 gene particularly the R620W allele are associated with an increased risk for these conditions. This variant affects the interaction of PTPN22 with C-SRC tyrosine kinase altering the normal immune signaling and contributing to the development of autoimmunity. Understanding the role of PTPN22 in these diseases offers potential targets for therapeutic interventions.

Specifications

Form

Liquid

General info

Function

Acts as a negative regulator of T-cell receptor (TCR) signaling by direct dephosphorylation of the Src family kinases LCK and FYN, ITAMs of the TCRz/CD3 complex, as well as ZAP70, VAV, VCP and other key signaling molecules (PubMed : 16461343, PubMed : 18056643). Associates with and probably dephosphorylates CBL. Dephosphorylates LCK at its activating 'Tyr-394' residue (PubMed : 21719704). Dephosphorylates ZAP70 at its activating 'Tyr-493' residue (PubMed : 16461343). Dephosphorylates the immune system activator SKAP2 (PubMed : 21719704). Positively regulates toll-like receptor (TLR)-induced type 1 interferon production (PubMed : 23871208). Promotes host antiviral responses mediated by type 1 interferon (By similarity). Regulates NOD2-induced pro-inflammatory cytokine secretion and autophagy (PubMed : 23991106). Acts as an activator of NLRP3 inflammasome assembly by mediating dephosphorylation of 'Tyr-861' of NLRP3 (PubMed : 27043286). Dephosphorylates phospho-anandamide (p-AEA), an endocannabinoid to anandamide (also called N-arachidonoylethanolamide) (By similarity).

Sequence similarities

Belongs to the protein-tyrosine phosphatase family. Non-receptor class 4 subfamily.

Post-translational modifications

Phosphorylation on Ser-35 by PKC/PRKCD abrogates its ability to dephosphorylate and inactivate the SRC family kinases.

Product protocols

Target data

Acts as a negative regulator of T-cell receptor (TCR) signaling by direct dephosphorylation of the Src family kinases LCK and FYN, ITAMs of the TCRz/CD3 complex, as well as ZAP70, VAV, VCP and other key signaling molecules (PubMed : 16461343, PubMed : 18056643). Associates with and probably dephosphorylates CBL. Dephosphorylates LCK at its activating 'Tyr-394' residue (PubMed : 21719704). Dephosphorylates ZAP70 at its activating 'Tyr-493' residue (PubMed : 16461343). Dephosphorylates the immune system activator SKAP2 (PubMed : 21719704). Positively regulates toll-like receptor (TLR)-induced type 1 interferon production (PubMed : 23871208). Promotes host antiviral responses mediated by type 1 interferon (By similarity). Regulates NOD2-induced pro-inflammatory cytokine secretion and autophagy (PubMed : 23991106). Acts as an activator of NLRP3 inflammasome assembly by mediating dephosphorylation of 'Tyr-861' of NLRP3 (PubMed : 27043286). Dephosphorylates phospho-anandamide (p-AEA), an endocannabinoid to anandamide (also called N-arachidonoylethanolamide) (By similarity).
See full target information PTPN22

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com