JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB236335

Recombinant Human PU.1/Spi1 protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human PU.1/Spi1 protein (His tag) is a Human Full Length protein, in the 1 to 270 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Transcription factor PU.1, 31 kDa-transforming protein, SPI1

3 Images
Mass Spectrometry - Recombinant Human PU.1/Spi1 protein (His tag) (AB236335)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human PU.1/Spi1 protein (His tag) (AB236335)

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab236335 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) PU.1/Spi1.

Mass Spectrometry - Recombinant Human PU.1/Spi1 protein (His tag) (AB236335)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human PU.1/Spi1 protein (His tag) (AB236335)

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab236335 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) PU.1/Spi1.

SDS-PAGE - Recombinant Human PU.1/Spi1 protein (His tag) (AB236335)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human PU.1/Spi1 protein (His tag) (AB236335)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) ananlysis with 5% enrichment gel and 15% separation gel of ab236335.

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

P17947

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRHPPH","proteinLength":"Full Length","predictedMolecularWeight":"35.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":270,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P17947","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

PU.1 also known as Spi1 is a transcription factor that belongs to the ETS family of transcription factors. It plays a major role in gene regulation and is an important player in hematopoietic cell differentiation. PU.1 has a molecular mass of approximately 31 kDa and is predominantly expressed in hematopoietic cells such as myeloid and B-lymphoid cells. It actively interacts with specific DNA sequences to regulate the expression of target genes.
Biological function summary

PU.1 influences the development and function of various blood cells including macrophages neutrophils and B-cells. It is essential for the regulation of genes involved in immune responses cell proliferation and survival. PU.1 functions as part of a larger transcriptional regulatory complex and often partners with other transcription factors and coactivators to exert its effects. This cooperation allows precise gene expression control in specific cell lineages.

Pathways

Expression of PU.1 is critical in the hematopoietic development pathway and the immune response pathway. It closely interacts with other transcription factors like GATA-1 and C/EBPα forming a network that affects hematopoietic lineage commitment. Within these pathways PU.1 constantly coordinates signals that influence progenitor cell fate and differentiation ensuring a balanced proportion of cell types within the blood.

PU.1 has significant implications in leukemia and other hematological malignancies. Dysregulation or mutation of PU.1 can lead to improper hematopoietic cell development and contribute to acute myeloid leukemia (AML) and other blood disorders. Additionally its expression level is closely linked with immune system function associating PU.1 indirectly with autoimmune conditions. In these contexts the interaction with other proteins like AML1 and C/EBPγ can influence disease pathogenesis by modulating gene expression patterns critical for normal hematopoietic and immune function.

Specifications

Form

Liquid

General info

Function

Pioneer transcription factor, which controls hematopoietic cell fate by decompacting stem cell heterochromatin and allowing other transcription factors to enter otherwise inaccessible genomic sites. Once in open chromatin, can directly control gene expression by binding genetic regulatory elements and can also more broadly influence transcription by recruiting transcription factors, such as interferon regulatory factors (IRFs), to otherwise inaccessible genomic regions (PubMed : 23658224, PubMed : 33951726). Transcriptionally activates genes important for myeloid and lymphoid lineages, such as CSF1R (By similarity). Transcriptional activation from certain promoters, possibly containing low affinity binding sites, is achieved cooperatively with other transcription factors. FCER1A transactivation is achieved in cooperation with GATA1 (By similarity). May be particularly important for the pro- to pre-B cell transition (PubMed : 33951726). Binds (via the ETS domain) onto the purine-rich DNA core sequence 5'-GAGGAA-3', also known as the PU-box (PubMed : 33951726). In vitro can bind RNA and interfere with pre-mRNA splicing (By similarity).

Sequence similarities

Belongs to the ETS family.

Subcellular localisation

Nucleus

Product protocols

Target data

Pioneer transcription factor, which controls hematopoietic cell fate by decompacting stem cell heterochromatin and allowing other transcription factors to enter otherwise inaccessible genomic sites. Once in open chromatin, can directly control gene expression by binding genetic regulatory elements and can also more broadly influence transcription by recruiting transcription factors, such as interferon regulatory factors (IRFs), to otherwise inaccessible genomic regions (PubMed : 23658224, PubMed : 33951726). Transcriptionally activates genes important for myeloid and lymphoid lineages, such as CSF1R (By similarity). Transcriptional activation from certain promoters, possibly containing low affinity binding sites, is achieved cooperatively with other transcription factors. FCER1A transactivation is achieved in cooperation with GATA1 (By similarity). May be particularly important for the pro- to pre-B cell transition (PubMed : 33951726). Binds (via the ETS domain) onto the purine-rich DNA core sequence 5'-GAGGAA-3', also known as the PU-box (PubMed : 33951726). In vitro can bind RNA and interfere with pre-mRNA splicing (By similarity).
See full target information SPI1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com