JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB180276

Recombinant Human Pur B protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Pur B protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 312 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Transcriptional regulator protein Pur-beta, Purine-rich element-binding protein B, PURB

1 Images
SDS-PAGE - Recombinant Human Pur B protein (His tag N-Terminus) (AB180276)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Pur B protein (His tag N-Terminus) (AB180276)

15% SDS-PAGE analysis of ab180276 (3μg).

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q96QR8

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMADGDSGSERGGGGGPCGFQPASRGGGEQETQELASKRLDIQNKRFYLDVKQNAKGRFLKIAEVGAGGSKSRLTLSMAVAAEFRDSLGDFIEHYAQLGPSSPEQLAAGAEEGGGPRRALKSEFLVRENRKYYLDLKENQRGRFLRIRQTVNRGGGGFGAGPGPGGLQSGQTIALPAQGLIEFRDALAKLIDDYGGEDDELAGGPGGGAGGPGGGLYGELPEGTSITVDSKRFFFDVGCNKYGVFLRVSEVKPSYRNAITVPFKAWGKFGGAFCRYADEMKEIQERQRDKLYERRGGGSGGGEESEGEEVDED","proteinLength":"Full Length","predictedMolecularWeight":"35.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":312,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q96QR8","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Pur B also known as purine-rich element-binding protein B is involved in DNA binding and transcriptional regulation. It is a 40 kDa protein localized in the nucleus and highly expressed in tissues with active cellular proliferation like the brain and the heart. Pur B associates with the purine-rich single-stranded DNA influencing the function and stability of genetic elements within these tissues.
Biological function summary

Pur B plays a significant role in cell growth and differentiation. It forms part of a multi-protein complex essential for regulating the expression of genes vital for cellular processes. The complex influences transcriptional activity altering how certain genes are turned on or off which ultimately impacts cellular function and development.

Pathways

Pur B is integral to the regulation of transcription and nucleic acid processes. It is involved in pathways like the response to stress and regulation of apoptosis. Within these pathways Pur B interacts with other transcription factors such as Pur A contributing to the precise control of gene expression essential for maintaining cellular integrity and responding to physiological changes.

Pur B displays an association with neurodegenerative diseases and cancer. Dysregulation of Pur B levels or function links to Alzheimer’s disease where it affects neural development and function often alongside Pur A. Additionally abnormal Pur B activity is observed in certain cancers potentially due to its role in gene transcription involved in cell proliferation where it might interact with oncogenic factors exacerbating tumor progression.

Specifications

Form

Liquid

Additional notes

ab180276 is purified using conventional chromatography techniques.

General info

Function

Transcriptional regulator which can act as an activator or a repressor. Represses the transcription of ACTA2 in fibroblasts and smooth muscle cells via its ability to interact with the purine-rich strand of a MCAT- containing element in the 5' flanking region of the gene. Represses the transcription of MYOCD, capable of repressing all isoforms of MYOCD but the magnitude of the repressive effects is most notable for the SMC- specific isoforms. Promotes hepatic glucose production by activating the transcription of ADCY6, leading to cAMP accumulation, increased PKA activity, CREB activation, and increased transcription of PCK1 and G6PC genes (By similarity). Has capacity to bind repeated elements in single-stranded DNA such as the purine-rich single strand of the PUR element located upstream of the MYC gene (PubMed : 1448097). Participates in transcriptional and translational regulation of alpha-MHC expression in cardiac myocytes by binding to the purine-rich negative regulatory (PNR) element Modulates constitutive liver galectin-3 gene transcription by binding to its promoter. May play a role in the dendritic transport of a subset of mRNAs (By similarity).

Sequence similarities

Belongs to the PUR DNA-binding protein family.

Subcellular localisation

Nucleus

Product protocols

Target data

Transcriptional regulator which can act as an activator or a repressor. Represses the transcription of ACTA2 in fibroblasts and smooth muscle cells via its ability to interact with the purine-rich strand of a MCAT- containing element in the 5' flanking region of the gene. Represses the transcription of MYOCD, capable of repressing all isoforms of MYOCD but the magnitude of the repressive effects is most notable for the SMC- specific isoforms. Promotes hepatic glucose production by activating the transcription of ADCY6, leading to cAMP accumulation, increased PKA activity, CREB activation, and increased transcription of PCK1 and G6PC genes (By similarity). Has capacity to bind repeated elements in single-stranded DNA such as the purine-rich single strand of the PUR element located upstream of the MYC gene (PubMed : 1448097). Participates in transcriptional and translational regulation of alpha-MHC expression in cardiac myocytes by binding to the purine-rich negative regulatory (PNR) element Modulates constitutive liver galectin-3 gene transcription by binding to its promoter. May play a role in the dendritic transport of a subset of mRNAs (By similarity).
See full target information PURB

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com