JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB98083

Recombinant Human PYM protein (His tag C-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human PYM protein (His tag C-Terminus) is a Human Full Length protein, in the 1 to 204 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE.

View Alternative Names

PYM, WIBG, PYM1, Partner of Y14 and mago, PYM homolog 1 exon junction complex-associated factor, Protein wibg homolog

2 Images
SDS-PAGE - Recombinant Human PYM protein (His tag C-Terminus) (AB98083)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human PYM protein (His tag C-Terminus) (AB98083)

3ug by SDS-PAGE under reducing conditions and visualized by coomassie blue stain.

SDS-PAGE - Recombinant Human PYM protein (His tag C-Terminus) (AB98083)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human PYM protein (His tag C-Terminus) (AB98083)

15% SDS-PAGE analysis of ab98083 (of 3μg)

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q9BRP8

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.316% Tris HCl, 0.00174% PMSF

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Previously labelled as WIBG.

Sequence info

[{"sequence":"MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSPEATAPVTPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQGSRAAPTAASDQPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEEELEDLELGLLEHHHHHH","proteinLength":"Full Length","predictedMolecularWeight":"23.7 kDa","actualMolecularWeight":null,"aminoAcidEnd":204,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9BRP8","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

PYM also known as PYM1 or Partner of Y14 and Magoh is a mechanistic component involved in the regulation of nonsense-mediated mRNA decay (NMD). It has a molecular mass of approximately 29 kDa. PYM is mainly expressed in the cytoplasm of cells particularly in regions with high cellular turnover such as the brain and testis. PYM interacts with the exon junction complex adjusting mRNA metabolism by binding to key components Y14 and Magoh facilitating mRNA surveillance.
Biological function summary

The PYM protein has significant influence on the mRNA surveillance machinery working as a modulator of NMD pathways. PYM is closely linked with the exon junction complex functioning with Y14 and Magoh to ensure mRNA molecules are properly processed for translation. It does not work alone; it forms part of a specialized complex that recognizes faulty mRNA with premature stop codons ensuring the upkeep of cellular mRNA quality.

Pathways

The PYM protein functions within the mRNA surveillance pathway which preserves integrity of gene expression. PYM interacts with Upf1 which plays a major role in detecting and initiating the degradation of faulty mRNA. It also connects with components of the mRNA export pathway ensuring only properly spliced and processed transcripts leave the nucleus. The partnership between PYM and other exon junction complex proteins contributes significantly to maintaining efficient and accurate gene expression protocols.

Errors in PYM function associate with neurological disorders due to its expression in the brain. Mutations or dysregulation here can affect mRNA quality control leading to ailments such as intellectual disability. PYM's interactions with Upf1 link it to disorders where NMD pathway errors occur further highlighting its importance in maintaining nervous system health. These associations highlight the potential for PYM as a target for therapeutic interventions in related conditions.

Specifications

Form

Liquid

Additional notes

ab98083 was purified by using conventional chromatography techniques.

General info

Function

Key regulator of the exon junction complex (EJC), a multiprotein complex that associates immediately upstream of the exon-exon junction on mRNAs and serves as a positional landmark for the intron exon structure of genes and directs post-transcriptional processes in the cytoplasm such as mRNA export, nonsense-mediated mRNA decay (NMD) or translation. Acts as an EJC disassembly factor, allowing translation-dependent EJC removal and recycling by disrupting mature EJC from spliced mRNAs. Its association with the 40S ribosomal subunit probably prevents a translation-independent disassembly of the EJC from spliced mRNAs, by restricting its activity to mRNAs that have been translated. Interferes with NMD and enhances translation of spliced mRNAs, probably by antagonizing EJC functions. May bind RNA; the relevance of RNA-binding remains unclear in vivo, RNA-binding was detected by PubMed : 14968132, while PubMed : 19410547 did not detect RNA-binding activity independently of the EJC.

Sequence similarities

Belongs to the pym family.

Subcellular localisation

Nucleus

Product protocols

Target data

Key regulator of the exon junction complex (EJC), a multiprotein complex that associates immediately upstream of the exon-exon junction on mRNAs and serves as a positional landmark for the intron exon structure of genes and directs post-transcriptional processes in the cytoplasm such as mRNA export, nonsense-mediated mRNA decay (NMD) or translation. Acts as an EJC disassembly factor, allowing translation-dependent EJC removal and recycling by disrupting mature EJC from spliced mRNAs. Its association with the 40S ribosomal subunit probably prevents a translation-independent disassembly of the EJC from spliced mRNAs, by restricting its activity to mRNAs that have been translated. Interferes with NMD and enhances translation of spliced mRNAs, probably by antagonizing EJC functions. May bind RNA; the relevance of RNA-binding remains unclear in vivo, RNA-binding was detected by PubMed : 14968132, while PubMed : 19410547 did not detect RNA-binding activity independently of the EJC.
See full target information PYM1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com