JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB158876

Recombinant Human Pyrin protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Pyrin protein (GST tag N-Terminus) is a Human Fragment protein, in the 1 to 110 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

MEF, TRIM20, MEFV, Pyrin, Marenostrin

1 Images
SDS-PAGE - Recombinant Human Pyrin protein (GST tag N-Terminus) (AB158876)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Pyrin protein (GST tag N-Terminus) (AB158876)

ab158876 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

O15553

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MAKTPSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSRIPRSQIQRARPVKMATLLVTYYGEEYAVQLTLQVLRAINQRLLAEELHRAAIQEYSTQENGTDDSAASSSL","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":110,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"O15553","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Pyrin also known as marenostrin or MEFV is a protein involved in the innate immune response. It has a molecular mass of about 88 kDa. Pyrin gets mainly expressed in neutrophils and macrophages cells integral to the body's defensive mechanisms. Mechanically this protein plays a role in modulating the assembly of inflammasomes which are multiprotein complexes essential for the production of pro-inflammatory cytokines such as interleukin-1 beta.
Biological function summary

Pyrin functions by interacting with the cytosolic adapter protein ASC forming part of the pyrin inflammasome complex. This interaction initiates an inflammatory response. The pyrin-meditated inflammasome assembly is important in regulating the body's response to pathogenic microorganisms and cellular stress. In addition to its immune role pyrin may regulate apoptosis the process of programmed cell death under certain conditions.

Pathways

The pyrin protein is a critical component of the inflammasome signaling pathway and the interleukin-1 signaling pathway. Within these pathways pyrin interacts directly with proteins like caspase-1 which processes pro-inflammatory cytokines into their active forms. These pathways play significant roles in various immune responses and help maintain homeostasis by modulating inflammation and cell death processes.

Pyrin mutations are linked to Familial Mediterranean Fever (FMF) and Behçet's disease. FMF a hereditary inflammatory disorder results from pyrin's inability to properly regulate inflammasome activity causing recurrent fever abdominal pain and inflammation in joints and skin. Additionally Behçet's disease characterized by recurrent oral and genital ulcers is associated with abnormal pyrin functioning. Changes in the pyrin protein may also interact with proteins like NLRP3 influencing susceptibility to these conditions.

Specifications

Form

Liquid

General info

Function

Involved in the regulation of innate immunity and the inflammatory response in response to IFNG/IFN-gamma (PubMed : 10807793, PubMed : 11468188, PubMed : 16037825, PubMed : 16785446, PubMed : 17431422, PubMed : 17964261, PubMed : 18577712, PubMed : 19109554, PubMed : 19584923, PubMed : 26347139, PubMed : 27030597, PubMed : 28835462). Organizes autophagic machinery by serving as a platform for the assembly of ULK1, Beclin 1/BECN1, ATG16L1, and ATG8 family members and recognizes specific autophagy targets, thus coordinating target recognition with assembly of the autophagic apparatus and initiation of autophagy (PubMed : 16785446, PubMed : 17431422, PubMed : 26347139). Acts as an autophagy receptor for the degradation of several inflammasome components, including CASP1, NLRP1 and NLRP3, hence preventing excessive IL1B- and IL18-mediated inflammation (PubMed : 16785446, PubMed : 17431422, PubMed : 26347139). However, it can also have a positive effect in the inflammatory pathway, acting as an innate immune sensor that triggers PYCARD/ASC specks formation, caspase-1 activation, and IL1B and IL18 production (PubMed : 16037825, PubMed : 27030597, PubMed : 28835462). Together with AIM2, also acts as a mediator of pyroptosis, necroptosis and apoptosis (PANoptosis), an integral part of host defense against pathogens, in response to bacterial infection (By similarity). It is required for PSTPIP1-induced PYCARD/ASC oligomerization and inflammasome formation (PubMed : 10807793, PubMed : 11468188, PubMed : 17964261, PubMed : 18577712, PubMed : 19109554, PubMed : 19584923). Recruits PSTPIP1 to inflammasomes, and is required for PSTPIP1 oligomerization (PubMed : 10807793, PubMed : 11468188, PubMed : 17964261, PubMed : 18577712, PubMed : 19109554, PubMed : 19584923).

Post-translational modifications

Cleaved by CASP1 (Probable). The N-terminal cleavage product localizes to the nucleus as a filamentous network and to the cytoplasm, interacts more strongly with RELA and NFKBIA than the full-length protein, enhances the nuclear localization of RELA and induces NFKBIA proteolysis. The C-terminal cleavage product localizes to the cytoplasm (Probable).. Phosphorylation at Ser-242 is required for the interaction with 14-3-3 proteins and down-regulation of pyrin pro-inflammatory activity.. Degraded along with the delivery of its substrates to autolysosomal compartments (at protein level).

Product protocols

Target data

Involved in the regulation of innate immunity and the inflammatory response in response to IFNG/IFN-gamma (PubMed : 10807793, PubMed : 11468188, PubMed : 16037825, PubMed : 16785446, PubMed : 17431422, PubMed : 17964261, PubMed : 18577712, PubMed : 19109554, PubMed : 19584923, PubMed : 26347139, PubMed : 27030597, PubMed : 28835462). Organizes autophagic machinery by serving as a platform for the assembly of ULK1, Beclin 1/BECN1, ATG16L1, and ATG8 family members and recognizes specific autophagy targets, thus coordinating target recognition with assembly of the autophagic apparatus and initiation of autophagy (PubMed : 16785446, PubMed : 17431422, PubMed : 26347139). Acts as an autophagy receptor for the degradation of several inflammasome components, including CASP1, NLRP1 and NLRP3, hence preventing excessive IL1B- and IL18-mediated inflammation (PubMed : 16785446, PubMed : 17431422, PubMed : 26347139). However, it can also have a positive effect in the inflammatory pathway, acting as an innate immune sensor that triggers PYCARD/ASC specks formation, caspase-1 activation, and IL1B and IL18 production (PubMed : 16037825, PubMed : 27030597, PubMed : 28835462). Together with AIM2, also acts as a mediator of pyroptosis, necroptosis and apoptosis (PANoptosis), an integral part of host defense against pathogens, in response to bacterial infection (By similarity). It is required for PSTPIP1-induced PYCARD/ASC oligomerization and inflammasome formation (PubMed : 10807793, PubMed : 11468188, PubMed : 17964261, PubMed : 18577712, PubMed : 19109554, PubMed : 19584923). Recruits PSTPIP1 to inflammasomes, and is required for PSTPIP1 oligomerization (PubMed : 10807793, PubMed : 11468188, PubMed : 17964261, PubMed : 18577712, PubMed : 19109554, PubMed : 19584923).
See full target information MEFV

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com