JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276657

Recombinant Human RAB1B protein (Fc Chimera)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human RAB1B protein (Fc Chimera) is a Human Fragment protein, in the 1 to 199 aa range, expressed in HEK 293 cells, with >90%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

Ras-related protein Rab-1B, RAB1B

1 Images
SDS-PAGE - Recombinant Human RAB1B protein (Fc Chimera) (AB276657)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human RAB1B protein (Fc Chimera) (AB276657)

SDS-PAGE analysis of ab276657

Key facts

Purity

>90% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

Fc tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q9H0U4

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: 100% PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGG","proteinLength":"Fragment","predictedMolecularWeight":"50.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":199,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q9H0U4","tags":[{"tag":"Fc","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

RAB1B also known as Ras-related protein Rab-1B is a member of the Rab family of small GTPases. This protein weighs approximately 22.6 kDa and is expressed in the cytoplasm. Mechanically RAB1B regulates vesicular trafficking between the endoplasmic reticulum (ER) and Golgi apparatus. This involves ensuring the proper budding movement and fusion of transport vesicles facilitating efficient transportation of proteins and lipids necessary for cellular function.
Biological function summary

RAB1B plays a role in maintaining cellular homeostasis and protein secretion. It is an important component of the protein transport machinery participating in vesicle coat complex formation. It regulates the movement between the ER and Golgi working closely with other Rab proteins and their effectors to keep the flow of materials steady. The localization and activity of RAB1B influence processes important for cell growth and differentiation.

Pathways

RAB1B operates significantly in the secretory and trafficking pathways. It connects with the Golgi apparatus and ER pathways participating in sorting and cellular signaling. RAB1B interacts with other proteins such as COPII and Golgi SNARE proteins to facilitate transport vesicle movement. These proteins and pathways ensure precise and organized intracellular cargo traffic impacting multiple cellular processes directly tied to the secretory pathway.

Disruptions in RAB1B function can connect to neurodegenerative diseases and cancers. Altered expression can affect protein transport linked to Alzheimer's disease where its dysregulation impacts ER-Golgi pathway proteins like APP. In various cancers abnormal RAB1B levels can influence proliferative signals and cellular stress responses. Understanding RAB1B's role helps to delineate its involvement in these diseases offering targets for therapeutic development.

Specifications

Form

Lyophilized

General info

Function

The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes (PubMed : 20545908, PubMed : 9437002, PubMed : 23236136). Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion (PubMed : 9437002). Plays a role in the initial events of the autophagic vacuole development which take place at specialized regions of the endoplasmic reticulum (PubMed : 20545908). Regulates vesicular transport between the endoplasmic reticulum and successive Golgi compartments (By similarity). Required to modulate the compacted morphology of the Golgi (PubMed : 26209634). Promotes the recruitment of lipid phosphatase MTMR6 to the endoplasmic reticulum-Golgi intermediate compartment (By similarity).

Sequence similarities

Belongs to the small GTPase superfamily. Rab family.

Post-translational modifications

Prenylated; by GGTase II, only after interaction of the substrate with Rab escort protein 1 (REP1).. (Microbial infection) AMPylation at Tyr-77 by L.pneumophila DrrA occurs in the switch 2 region and leads to moderate inactivation of the GTPase activity. It appears to prolong the lifetime of the GTP state of RAB1B by restricting access of GTPase effectors to switch 2 and blocking effector-stimulated GTP hydrolysis, thereby rendering RAB1B constitutively active. It is later de-AMPylated by L.pneumophila SidD, releasing RAB1B from bacterial phagosomes.. (Microbial infection) Phosphocholinated at Ser-76 by L.pneumophila AnkX, leading to displace GDP dissociation inhibitors (GDI) (PubMed:21822290, PubMed:22307087). Both GDP-bound and GTP-bound forms can be phosphocholinated. Dephosphocholinated by L.pneumophila Lem3, restoring accessibility to L.pneumophila GTPase effector LepB (PubMed:22158903, PubMed:22307087).. (Microbial infection) Glycosylated by S.typhimurium protein Ssek3: arginine GlcNAcylation prevents GTPase activity, thereby disrupting vesicular protein transport from the endoplasmic reticulum (ER) to the Golgi compartment.

Product protocols

Target data

The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes (PubMed : 20545908, PubMed : 9437002, PubMed : 23236136). Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion (PubMed : 9437002). Plays a role in the initial events of the autophagic vacuole development which take place at specialized regions of the endoplasmic reticulum (PubMed : 20545908). Regulates vesicular transport between the endoplasmic reticulum and successive Golgi compartments (By similarity). Required to modulate the compacted morphology of the Golgi (PubMed : 26209634). Promotes the recruitment of lipid phosphatase MTMR6 to the endoplasmic reticulum-Golgi intermediate compartment (By similarity).
See full target information Ras-related protein Rab-1B

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com