JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB160266

Recombinant Human RAB29 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human RAB29 protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 203 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

RAB7L1, RAB29, Ras-related protein Rab-29, Rab-7-like protein 1, Ras-related protein Rab-7L1

1 Images
SDS-PAGE - Recombinant Human RAB29 protein (GST tag N-Terminus) (AB160266)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human RAB29 protein (GST tag N-Terminus) (AB160266)

ab160266 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

O14966

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSWSCC","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":203,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"O14966","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

RAB29 also known as Rab7L1 is a member of the RAB family of small GTPases. This protein is involved in vesicle trafficking processes within cells. RAB29 has an approximate mass of 23 kDa. It is expressed in various tissues but shows higher expression levels in brain and testis. In cellular functions it acts mainly within the endosomal-lysosomal system to regulate membrane trafficking events.
Biological function summary

RAB29 plays an important role in ensuring the proper transport and sorting of proteins within cells. It associates with certain effector proteins to form complexes which facilitate movement between endosomes and other intracellular compartments. It coordinates with other RAB proteins to maintain cellular homeostasis and ensure effective intracellular transport. This coordination is significant for neural cells suggesting a specific importance in neurological environments.

Pathways

RAB29 engages in intracellular trafficking pathways that include the endocytic pathway and Golgi-lysosomal trafficking. In these pathways it cooperates closely with proteins like LRRK2 to regulate autophagy and the maintenance of the endosomal membrane system. Through these pathways it maintains cellular organelle distribution and affects lysosome functionality impacting overall cell health and metabolism.

RAB29 exhibits connections to neurodegenerative disorders such as Parkinson’s disease. Mutations or dysfunctions in RAB29 along with its interaction partner LRRK2 have been linked to the pathogenesis of this disorder implicating it in the degeneration of dopaminergic neurons. Additionally aberrant RAB29 activity has been associated with complications in lysosomal storage diseases suggesting its broader implications in cellular waste handling and turnover.

Specifications

Form

Liquid

General info

Function

The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes (PubMed : 24788816). Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion (By similarity). RAB29 is essential for maintaining the integrity of the endosome-trans-Golgi network structure (By similarity). Together with LRRK2, plays a role in the retrograde trafficking pathway for recycling proteins, such as mannose 6 phosphate receptor (M6PR), between lysosomes and the Golgi apparatus in a retromer-dependent manner (PubMed : 24788816). Recruits LRRK2 to the Golgi complex and stimulates LRRK2 kinase activity (PubMed : 29212815, PubMed : 38127736). Stimulates phosphorylation of RAB10 'Thr-73' by LRRK2 (PubMed : 38127736). Regulates neuronal process morphology in the intact central nervous system (CNS) (By similarity). May play a role in the formation of typhoid toxin transport intermediates during Salmonella enterica serovar Typhi (S.typhi) epithelial cell infection (PubMed : 22042847).

Sequence similarities

Belongs to the small GTPase superfamily. Rab family.

Post-translational modifications

In case of Salmonella enterica serovar Typhimurium (S.typhimurium) infection, is proteolytically cleaved between Gly-41 and Val-42 by the GtgE viral protease encoded on the Gifsy-2 lysogen bacteriophage, which therefore prevents the recruitment of RAB29 to S.typhimurium-containing vacuoles. In contrast, no proteolytically cleavage is detected in S.typhi-infected cells (PubMed:22042847).

Subcellular localisation

Vacuole

Product protocols

Target data

The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes (PubMed : 24788816). Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion (By similarity). RAB29 is essential for maintaining the integrity of the endosome-trans-Golgi network structure (By similarity). Together with LRRK2, plays a role in the retrograde trafficking pathway for recycling proteins, such as mannose 6 phosphate receptor (M6PR), between lysosomes and the Golgi apparatus in a retromer-dependent manner (PubMed : 24788816). Recruits LRRK2 to the Golgi complex and stimulates LRRK2 kinase activity (PubMed : 29212815, PubMed : 38127736). Stimulates phosphorylation of RAB10 'Thr-73' by LRRK2 (PubMed : 38127736). Regulates neuronal process morphology in the intact central nervous system (CNS) (By similarity). May play a role in the formation of typhoid toxin transport intermediates during Salmonella enterica serovar Typhi (S.typhi) epithelial cell infection (PubMed : 22042847).
See full target information RAB29

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com