JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB124565

Recombinant Human RAB31 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human RAB31 protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 195 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

RAB22B, RAB31, Ras-related protein Rab-31, Ras-related protein Rab-22B

1 Images
SDS-PAGE - Recombinant Human RAB31 protein (His tag N-Terminus) (AB124565)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human RAB31 protein (His tag N-Terminus) (AB124565)

ab124565 (3µg) visualised by SDS-PAGE (15%).

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q13636

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 30% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHLHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRC","proteinLength":"Full Length","predictedMolecularWeight":"25.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":195,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q13636","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

RAB31 also known as RAB22B belongs to the RAB family which plays an important role in vesicular trafficking. It is a small GTPase with a mass of approximately 23 kDa. RAB31 is mainly expressed in epithelial tissues and certain cancer cell lines. It regulates vesicle formation movement and fusion by cycling between an active GTP-bound state and an inactive GDP-bound state. This cycling is important for its function in the intracellular transport system.
Biological function summary

RAB31 influences early endosome dynamics and directly impacts the sorting and recycling of receptors. It associates with effector proteins to form protein complexes that facilitate endocytosis and exocytosis processes. It also interacts with other Rab proteins to ensure proper membrane specificity and temporal regulation within cellular compartments. This behavior highlights its role in maintaining cellular homeostasis and responsiveness to environmental changes.

Pathways

Studies have shown that RAB31 contributes significantly to the endocytic pathway and the insulin signaling pathway. It has functional interactions with proteins like RAB5 and RAB11 both of which are key regulators of endosomal trafficking. RAB31 ensures a proper transport cycle that influences receptor recycling and signaling impacting how cells respond to growth factors and hormones.

Research implicates RAB31 in the progression of certain cancers such as breast cancer due to its established role in vesicle trafficking and receptor recycling which can affect cell growth and division. Its altered expression levels may intersect with proteins such as EGFR leading to abnormal signaling cascades. Furthermore RAB31 has associations with metabolic disorders as disruptions in insulin signaling pathways may contribute to diabetes showcasing its diverse influence on human health.

Specifications

Form

Liquid

Additional notes

ab124565 was purified by conventional chromatography techniques.

General info

Function

The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. Required for the integrity and for normal function of the Golgi apparatus and the trans-Golgi network. Plays a role in insulin-stimulated translocation of GLUT4 to the cell membrane. Plays a role in M6PR transport from the trans-Golgi network to endosomes. Plays a role in the internalization of EGFR from the cell membrane into endosomes. Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis.

Sequence similarities

Belongs to the small GTPase superfamily. Rab family.

Subcellular localisation

Early endosome

Product protocols

Target data

The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. Required for the integrity and for normal function of the Golgi apparatus and the trans-Golgi network. Plays a role in insulin-stimulated translocation of GLUT4 to the cell membrane. Plays a role in M6PR transport from the trans-Golgi network to endosomes. Plays a role in the internalization of EGFR from the cell membrane into endosomes. Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis.
See full target information RAB31

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com