JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB187445

Recombinant Human RAB39B protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human RAB39B protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 213 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Ras-related protein Rab-39B, RAB39B

1 Images
SDS-PAGE - Recombinant Human RAB39B protein (His tag N-Terminus) (AB187445)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human RAB39B protein (His tag N-Terminus) (AB187445)

15% SDS-PAGE analysis of ab187445 (3μg).

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Q96DA2

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS, 30% Glycerol (glycerin, glycerine), 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVPNVVHSSEEVVKSERRCLC","proteinLength":"Full Length","predictedMolecularWeight":"27 kDa","actualMolecularWeight":null,"aminoAcidEnd":213,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q96DA2","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

RAB39B also known as Ras-related protein Rab-39B is a member of the Rab family of small GTPases which has a molecular mass of approximately 26 kDa. RAB39B is expressed in several tissues but it shows higher expression levels in the brain. Mechanically RAB39B is involved in the regulation of intracellular vesicle trafficking specifically linked to endosome dynamics. This protein functions by switching between active GTP-bound and inactive GDP-bound states influencing membrane trafficking along actin and tubulin networks.
Biological function summary

RAB39B plays a role in synapse function and maintenance. This protein associates with cellular membranes and is involved in the trafficking of AMPA receptors to the neuronal surface which impacts synaptic plasticity and neurotransmission. Although not typically described as part of a large complex RAB39B works in close association with other synaptic proteins to ensure proper synaptic function. Its function in neurons highlights the importance of precise vesicular trafficking in neurotransmitter release and synaptic strength.

Pathways

RAB39B is integral to the endocytic trafficking and recycling pathways. It collaborates with key proteins like Rab7 and Rab5 in these cellular processes ensuring the proper sorting and recycling of synaptic vesicles. This precise control contributes to cellular homeostasis and efficient signal transmission at synapses which is critical for neuronal communication and overall brain function.

RAB39B is linked to neurodevelopmental disorders and has a significant connection to Parkinson's disease. Mutations in RAB39B can lead to intellectual disabilities and autism spectrum disorders. In the context of Parkinson's disease altered RAB39B function has been associated with the pathogenesis where it interacts with alpha-synuclein a protein significantly implicated in the disorder. These connections highlight the importance of RAB39B in maintaining neurological health and its potential as a therapeutic target.

Specifications

Form

Liquid

Additional notes

ab187445 was purified using conventional chromatography techniques.

General info

Function

Small GTPases Rab involved in autophagy (PubMed : 27103069). The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion (PubMed : 27103069). May regulate the homeostasis of SNCA/alpha-synuclein. Together with PICK1 proposed to ensure selectively GRIA2 exit from the endoplasmic reticulum to the Golgi and to regulate AMPAR compostion at the post-synapses and thus synaptic transmission (By similarity).

Sequence similarities

Belongs to the small GTPase superfamily. Rab family.

Product protocols

Target data

Small GTPases Rab involved in autophagy (PubMed : 27103069). The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion (PubMed : 27103069). May regulate the homeostasis of SNCA/alpha-synuclein. Together with PICK1 proposed to ensure selectively GRIA2 exit from the endoplasmic reticulum to the Golgi and to regulate AMPAR compostion at the post-synapses and thus synaptic transmission (By similarity).
See full target information RAB39B

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com