JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB109964

Recombinant Human Rab3A protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Rab3A protein is a Human Full Length protein, in the 1 to 220 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Ras-related protein Rab-3A, RAB3A

1 Images
SDS-PAGE - Recombinant Human Rab3A protein (AB109964)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Rab3A protein (AB109964)

15% SDS-PAGE analysis of 3μg ab109964.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

P20336

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.316% Tris HCl, 0.058% Sodium chloride, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC","proteinLength":"Full Length","predictedMolecularWeight":"27.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":220,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P20336","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Rab3A also known as Ras-related protein Rab-3A acts as a small GTPase involved in regulating membrane trafficking. Its molecular mass is approximately 25 kDa. Rab3A is highly expressed in neurons particularly at synaptic vesicles. It cycles between an active GTP-bound state and an inactive GDP-bound state to regulate the docking and fusion of synaptic vesicles with the presynaptic membrane.
Biological function summary

Rab3A facilitates neurotransmitter release by interacting with effector proteins such as RIM and Rabphilin-3A. It is part of a larger complex that includes the SNAREs which help mediate synaptic vesicle fusion. Through its regulatory action Rab3A ensures that neurotransmitters are released in a controlled manner during synaptic transmission which is essential for proper neuronal communication.

Pathways

Rab3A participates in the synaptic vesicle cycle which is vital in neurotransmitter release. This cycle involves key proteins like Syntaxin and VAMP. Rab3A interacts with these SNARE proteins to participate in vesicle docking and priming. Additionally it plays a role in the calcium-dependent exocytosis pathway which relies on calcium ions triggering vesicle fusion at nerve terminals.

Rab3A associates with neurological conditions such as epilepsy and synaptic dysfunction. Dysfunction in Rab3A mechanisms can lead to improper neurotransmitter release and synaptic connectivity contributing to these conditions. The protein links to diseases through its interactions with proteins such as RIM which can also affect synaptic function and are implicated in certain neurodevelopmental disorders.

Specifications

Form

Liquid

Additional notes

ab109964 was purified using conventional chromatography techniques.

General info

Function

Small GTP-binding protein that plays a central role in regulated exocytosis and secretion. Controls the recruitment, tethering and docking of secretory vesicles to the plasma membrane (By similarity). Upon stimulation, switches to its active GTP-bound form, cycles to vesicles and recruits effectors such as RIMS1, RIMS2, Rabphilin-3A/RPH3A, RPH3AL or SYTL4 to help the docking of vesicules onto the plasma membrane (By similarity). Upon GTP hydrolysis by GTPase-activating protein, dissociates from the vesicle membrane allowing the exocytosis to proceed (By similarity). Stimulates insulin secretion through interaction with RIMS2 or RPH3AL effectors in pancreatic beta cells (By similarity). Regulates calcium-dependent lysosome exocytosis and plasma membrane repair (PMR) via the interaction with 2 effectors, SYTL4 and myosin-9/MYH9 (PubMed : 27325790). Acts as a positive regulator of acrosome content secretion in sperm cells by interacting with RIMS1 (PubMed : 22248876, PubMed : 30599141). Also plays a role in the regulation of dopamine release by interacting with synaptotagmin I/SYT (By similarity). Interacts with MADD (via uDENN domain); the GTP-bound form is preferred for interaction (By similarity).

Sequence similarities

Belongs to the small GTPase superfamily. Rab family.

Post-translational modifications

Phosphorylation of Thr-86 in the switch II region by LRRK2 prevents the association of RAB regulatory proteins, including CHM, CHML and RAB GDP dissociation inhibitors GDI1 and GDI2.

Subcellular localisation

Lysosome

Product protocols

Target data

Small GTP-binding protein that plays a central role in regulated exocytosis and secretion. Controls the recruitment, tethering and docking of secretory vesicles to the plasma membrane (By similarity). Upon stimulation, switches to its active GTP-bound form, cycles to vesicles and recruits effectors such as RIMS1, RIMS2, Rabphilin-3A/RPH3A, RPH3AL or SYTL4 to help the docking of vesicules onto the plasma membrane (By similarity). Upon GTP hydrolysis by GTPase-activating protein, dissociates from the vesicle membrane allowing the exocytosis to proceed (By similarity). Stimulates insulin secretion through interaction with RIMS2 or RPH3AL effectors in pancreatic beta cells (By similarity). Regulates calcium-dependent lysosome exocytosis and plasma membrane repair (PMR) via the interaction with 2 effectors, SYTL4 and myosin-9/MYH9 (PubMed : 27325790). Acts as a positive regulator of acrosome content secretion in sperm cells by interacting with RIMS1 (PubMed : 22248876, PubMed : 30599141). Also plays a role in the regulation of dopamine release by interacting with synaptotagmin I/SYT (By similarity). Interacts with MADD (via uDENN domain); the GTP-bound form is preferred for interaction (By similarity).
See full target information RAB3A

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com