JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB245929

Recombinant Human Rab5 protein (His tag)

5

(1 Review)

|

(0 Publication)

Recombinant Human Rab5 protein (His tag) is a Human Full Length protein, in the 1 to 215 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, WB.

View Alternative Names

RAB5, RAB5A, Ras-related protein Rab-5A

1 Images
SDS-PAGE - Recombinant Human Rab5 protein (His tag) (AB245929)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Rab5 protein (His tag) (AB245929)

SDS-PAGE analysis of Recombinant Human Rab5 protein (His tag) (ab245929)

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, WB

applications

Biologically active

No

Accession

P20339

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.5 Constituents: 10% Glycerol (glycerin, glycerine), 2.61% Sodium chloride, 0.32% Tris HCl, 0.08% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN","proteinLength":"Full Length","predictedMolecularWeight":"26 kDa","actualMolecularWeight":null,"aminoAcidEnd":215,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P20339","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Rab5 also known as Ras-related protein Rab-5A is a small GTPase of approximately 24 kDa. It is part of the Rab family of proteins and functions as an endosomal marker in cells. Rab5 is ubiquitously expressed but shows enriched expression in tissues with a high rate of endocytosis like the brain and liver. This protein plays a significant role in early endosome fusion and trafficking acting as an essential regulator of vesicular transport processes within the cell.
Biological function summary

Rab5 regulates the early endocytic pathway by mediating vesicle docking and fusion processes. It is not a part of a large complex but interacts with a range of effector proteins that facilitate endosome maturation. Rab5's role as an endosomal marker makes it important for membrane trafficking receptor recycling and signal transduction. Researchers often identify Rab5 in cellular studies using endosome staining techniques or specific antibodies like Drosophila antibodies to visualize its function and distribution.

Pathways

The endocytic network heavily involves Rab5 particularly influencing the endocytosis and endosomal signaling pathways. It frequently interacts with proteins such as EEA1 (Early Endosome Antigen 1) and Rabaptin-5 which are critical for endosomal membrane fusion. This mechanistic involvement ensures the correct transfer and processing of endocytic vesicles facilitating the continual cycle of membrane and receptor turnover in cells.

Rab5 dysfunction associates with neurological conditions such as Alzheimer's disease and cancer. Alterations in Rab5 levels or function can disrupt normal endosomal trafficking leading to amyloid beta peptide accumulation in Alzheimer's. Additionally Rab5's role in cancer relates to its regulation of growth factor receptors where its interaction with proteins like the PE marker influences tumor progression. Understanding Rab5 pathways and interactions paves the way for developing targeted therapeutics in these disorders.

Specifications

Form

Liquid

Additional notes

Affinity Purified

General info

Function

Small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, binds to a variety of effector proteins to regulate cellular responses such as of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Active GTP-bound form is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. RAB5A is required for the fusion of plasma membranes and early endosomes (PubMed : 10818110, PubMed : 14617813, PubMed : 15378032, PubMed : 16410077). Contributes to the regulation of filopodia extension (PubMed : 14978216). Required for the exosomal release of SDCBP, CD63, PDCD6IP and syndecan (PubMed : 22660413). Regulates maturation of apoptotic cell-containing phagosomes, probably downstream of DYN2 and PIK3C3 (By similarity).

Sequence similarities

Belongs to the small GTPase superfamily. Rab family.

Post-translational modifications

Phosphorylation of Ser-84 in the switch II region by LRRK2 prevents the association of RAB regulatory proteins, including RAB GDP dissociation inhibitors GDI1 and GDI2.. (Microbial infection) Glycosylated on arginine residues by S.typhimurium protein Ssek3.

Subcellular localisation

Early endosome membrane

Product protocols

Target data

Small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, binds to a variety of effector proteins to regulate cellular responses such as of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Active GTP-bound form is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. RAB5A is required for the fusion of plasma membranes and early endosomes (PubMed : 10818110, PubMed : 14617813, PubMed : 15378032, PubMed : 16410077). Contributes to the regulation of filopodia extension (PubMed : 14978216). Required for the exosomal release of SDCBP, CD63, PDCD6IP and syndecan (PubMed : 22660413). Regulates maturation of apoptotic cell-containing phagosomes, probably downstream of DYN2 and PIK3C3 (By similarity).
See full target information RAB5A

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com