JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB51014

Recombinant Human Rac1 protein (Tag Free)

5

(1 Review)

|

(1 Publication)

Recombinant Human Rac1 protein (Tag Free) is a Human Full Length protein, in the 1 to 192 aa range, expressed in Escherichia coli, with >95%.

View Alternative Names

TC25, MIG5, RAC1, Ras-related C3 botulinum toxin substrate 1, Cell migration-inducing gene 5 protein, Ras-like protein TC25, p21-Rac1

1 Images
SDS-PAGE - Recombinant Human Rac1 protein (Tag Free) (AB51014)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Rac1 protein (Tag Free) (AB51014)

15% SDS-PAGE analysis of 3 μg ab51014.

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

Tag free

Biologically active

No

Accession

P63000

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.5 Constituents: 10% Glycerol (glycerin, glycerine), 0.316% Tris HCl, 0.0584% EDTA, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Sequence info

[{"sequence":"MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":192,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P63000","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Rac1 also known as Ras-related C3 botulinum toxin substrate 1 is a small signaling GTPase belonging to the Rac subfamily of the Rho family of GTPases. It has a molecular mass of approximately 21 kDa. Rac1 functions as a molecular switch and is involved in transmitting signals within the cell. It is widely expressed across various cell types and tissues playing a role in actin cytoskeleton organization and cell migration. Rac1 activity is regulated by GEFs (guanine nucleotide exchange factors) and GAPs (GTPase-activating proteins) which facilitate its transition between an active GTP-bound state and an inactive GDP-bound state.
Biological function summary

Rac1 is involved in the regulation of various cellular processes such as cell growth motility and division. It also contributes to the formation of lamellipodia which are membrane protrusions involved in cell movement and adhesion. Rac1 is often found within complexes interacting with other proteins like EH domain-containing protein 1 (Ehop) and is an important player in signal transduction pathways involving the cytoskeleton. Inhibition of Rac1 activity is an important point of control in various cellular contexts impacting multiple downstream effects.

Pathways

Rac1 is an integral component of the Rho GTPase signaling pathway and the closely associated Wnt signaling pathway. It interacts with proteins such as GAP and GEF to regulate the dynamics of these pathways influencing cellular morphology and movement. These pathways further connect Rac1 to several downstream effectors demonstrating its role in intracellular communication and control. EHOP-016 is a known inhibitor that specifically targets Rac1 demonstrating potential for experimental modulation of pathways involving Rac1.

Rac1 has been implicated in cancer particularly in its role in cell proliferation and migration that contributes to tumor growth and metastasis. Rac1’s aberrant regulation is associated with other disorders like neurodegenerative diseases where disruptions in cytoskeletal dynamics contribute to pathogenesis. It shares pathways with other proteins such as GEFs and GAPs which are also relevant in these conditions. Rac1's interaction with its regulatory partners makes it a significant focus in therapeutic strategies aiming to mitigate its pathogenic effects.

Specifications

Form

Liquid

General info

Function

Plasma membrane-associated small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, binds to a variety of effector proteins to regulate cellular responses such as secretory processes, phagocytosis of apoptotic cells, epithelial cell polarization, neurons adhesion, migration and differentiation, and growth-factor induced formation of membrane ruffles (PubMed : 1643658, PubMed : 22843693, PubMed : 23512198, PubMed : 28886345). Rac1 p21/rho GDI heterodimer is the active component of the cytosolic factor sigma 1, which is involved in stimulation of the NADPH oxidase activity in macrophages. Essential for the SPATA13-mediated regulation of cell migration and adhesion assembly and disassembly. Stimulates PKN2 kinase activity (PubMed : 9121475). In concert with RAB7A, plays a role in regulating the formation of RBs (ruffled borders) in osteoclasts (PubMed : 1643658). In podocytes, promotes nuclear shuttling of NR3C2; this modulation is required for a proper kidney functioning. Required for atypical chemokine receptor ACKR2-induced LIMK1-PAK1-dependent phosphorylation of cofilin (CFL1) and for up-regulation of ACKR2 from endosomal compartment to cell membrane, increasing its efficiency in chemokine uptake and degradation. In neurons, is involved in dendritic spine formation and synaptic plasticity (By similarity). In hippocampal neurons, involved in spine morphogenesis and synapse formation, through local activation at synapses by guanine nucleotide exchange factors (GEFs), such as ARHGEF6/ARHGEF7/PIX (PubMed : 12695502). In synapses, seems to mediate the regulation of F-actin cluster formation performed by SHANK3. In neurons, plays a crucial role in regulating GABA(A) receptor synaptic stability and hence GABAergic inhibitory synaptic transmission through its role in PAK1 activation and eventually F-actin stabilization (By similarity). Required for DSG3 translocation to cell-cell junctions, DSG3-mediated organization of cortical F-actin bundles and anchoring of actin at cell junctions; via interaction with DSG3 (PubMed : 22796473).. Isoform B. Isoform B has an accelerated GEF-independent GDP/GTP exchange and an impaired GTP hydrolysis, which is restored partially by GTPase-activating proteins (PubMed : 14625275). It is able to bind to the GTPase-binding domain of PAK but not full-length PAK in a GTP-dependent manner, suggesting that the insertion does not completely abolish effector interaction (PubMed : 14625275).

Sequence similarities

Belongs to the small GTPase superfamily. Rho family.

Post-translational modifications

GTP-bound active form is ubiquitinated at Lys-147 by HACE1, leading to its degradation by the proteasome.. Phosphorylated by AKT at Ser-71.. Ubiquitinated at Lys-166 in a FBXL19-mediated manner; leading to proteasomal degradation.. (Microbial infection) AMPylation at Tyr-32 and Thr-35 are mediated by bacterial enzymes in case of infection by H.somnus and V.parahaemolyticus, respectively. AMPylation occurs in the effector region and leads to inactivation of the GTPase activity by preventing the interaction with downstream effectors, thereby inhibiting actin assembly in infected cells. It is unclear whether some human enzyme mediates AMPylation; FICD has such ability in vitro but additional experiments remain to be done to confirm results in vivo.. (Microbial infection) Glycosylated at Tyr-32 by Photorhabdus asymbiotica toxin PAU_02230. Mono-O-GlcNAcylation by PAU_02230 inhibits downstream signaling by an impaired interaction with diverse regulator and effector proteins of Rac and leads to actin disassembly.. (Microbial infection) Glucosylated at Thr-35 by C.difficile toxins TcdA and TcdB in the colonic epithelium, and by P.sordellii toxin TcsL in the vascular endothelium (PubMed:19744486, PubMed:24905543, PubMed:7775453, PubMed:7777059, PubMed:8626575). Monoglucosylation completely prevents the recognition of the downstream effector, blocking the GTPases in their inactive form, leading to actin cytoskeleton disruption and cell death, resulting in the loss of colonic epithelial barrier function (PubMed:7775453, PubMed:7777059).. (Microbial infection) Glycosylated (O-GlcNAcylated) at Thr-35 by C.novyi toxin TcdA (PubMed:8810274). O-GlcNAcylation completely prevents the recognition of the downstream effector, blocking the GTPases in their inactive form, leading to actin cytoskeleton disruption (PubMed:8810274).. (Microbial infection) Palmitoylated by the N-epsilon-fatty acyltransferase F2 chain of V.cholerae toxin RtxA (PubMed:29074776). Palmitoylation inhibits activation by guanine nucleotide exchange factors (GEFs), preventing Rho GTPase signaling (PubMed:29074776).

Subcellular localisation

Nucleus

Product protocols

Target data

Plasma membrane-associated small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, binds to a variety of effector proteins to regulate cellular responses such as secretory processes, phagocytosis of apoptotic cells, epithelial cell polarization, neurons adhesion, migration and differentiation, and growth-factor induced formation of membrane ruffles (PubMed : 1643658, PubMed : 22843693, PubMed : 23512198, PubMed : 28886345). Rac1 p21/rho GDI heterodimer is the active component of the cytosolic factor sigma 1, which is involved in stimulation of the NADPH oxidase activity in macrophages. Essential for the SPATA13-mediated regulation of cell migration and adhesion assembly and disassembly. Stimulates PKN2 kinase activity (PubMed : 9121475). In concert with RAB7A, plays a role in regulating the formation of RBs (ruffled borders) in osteoclasts (PubMed : 1643658). In podocytes, promotes nuclear shuttling of NR3C2; this modulation is required for a proper kidney functioning. Required for atypical chemokine receptor ACKR2-induced LIMK1-PAK1-dependent phosphorylation of cofilin (CFL1) and for up-regulation of ACKR2 from endosomal compartment to cell membrane, increasing its efficiency in chemokine uptake and degradation. In neurons, is involved in dendritic spine formation and synaptic plasticity (By similarity). In hippocampal neurons, involved in spine morphogenesis and synapse formation, through local activation at synapses by guanine nucleotide exchange factors (GEFs), such as ARHGEF6/ARHGEF7/PIX (PubMed : 12695502). In synapses, seems to mediate the regulation of F-actin cluster formation performed by SHANK3. In neurons, plays a crucial role in regulating GABA(A) receptor synaptic stability and hence GABAergic inhibitory synaptic transmission through its role in PAK1 activation and eventually F-actin stabilization (By similarity). Required for DSG3 translocation to cell-cell junctions, DSG3-mediated organization of cortical F-actin bundles and anchoring of actin at cell junctions; via interaction with DSG3 (PubMed : 22796473).. Isoform B. Isoform B has an accelerated GEF-independent GDP/GTP exchange and an impaired GTP hydrolysis, which is restored partially by GTPase-activating proteins (PubMed : 14625275). It is able to bind to the GTPase-binding domain of PAK but not full-length PAK in a GTP-dependent manner, suggesting that the insertion does not completely abolish effector interaction (PubMed : 14625275).
See full target information RAC1

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Cell reports 35:108972 PubMed33852856

2021

Dihydroceramide desaturase regulates the compartmentalization of Rac1 for neuronal oxidative stress.

Applications

Unspecified application

Species

Unspecified reactive species

Fei-Yang Tzou,Tsu-Yi Su,Wan-Syuan Lin,Han-Chun Kuo,Yu-Lian Yu,Yu-Han Yeh,Chung-Chih Liu,Ching-Hua Kuo,Shu-Yi Huang,Chih-Chiang Chan
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com