JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB174397

Recombinant Human Rad51L1/RAD51B protein (denatured) (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Rad51L1/RAD51B protein (denatured) (His tag N-Terminus) is a Human Full Length protein, in the 1 to 350 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE.

View Alternative Names

RAD51L1, REC2, RAD51B, DNA repair protein RAD51 homolog 2, R51H2, RAD51 homolog B, RAD51-like protein 1, Rad51B

2 Images
SDS-PAGE - Recombinant Human Rad51L1/RAD51B protein (denatured) (His tag N-Terminus) (AB174397)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Rad51L1/RAD51B protein (denatured) (His tag N-Terminus) (AB174397)

15% SDS-PAGE analysis of ab174397 (3μg).

SDS-PAGE - Recombinant Human Rad51L1/RAD51B protein (denatured) (His tag N-Terminus) (AB174397)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Rad51L1/RAD51B protein (denatured) (His tag N-Terminus) (AB174397)

3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

O15315

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 2.4% Urea, 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as Rad51L1

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQAYGNS","proteinLength":"Full Length","predictedMolecularWeight":"40.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":350,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O15315","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Rad51L1 also known as RAD51B is a protein that plays an important role in the homologous recombination repair of DNA. It has a molecular weight of about 37 kDa. This protein is mainly expressed in the nucleus of cells where it takes part in the process of repairing double-strand breaks by facilitating the search for homology and DNA strand pairing. While its expression is widespread its levels can vary depending on the tissue and the state of cell proliferation.
Biological function summary

This protein acts as a DNA repair agent. It forms a complex with RAD51 and other recombinational repair proteins to promote genetic stability. Through this action Rad51L1 helps ensure that errors introduced during DNA replication or by external damage are corrected effectively. The resulting stability maintains genomic integrity which is essential for normal cellular functions.

Pathways

Rad51L1 is a critical component of the DNA repair pathways especially the homologous recombination pathway which serves to preserve genome stability. It works closely alongside other proteins such as RAD51 and BRCA2 in these pathways. By assisting in the alignment of homologous DNA sequences Rad51L1 helps mitigate genotoxic stresses that if unchecked could lead to mutations and cancerous transformations.

Rad51L1 has been implicated in certain forms of cancer like breast cancer due to its role in DNA repair. Its interaction with the BRCA2 protein is particularly notable as mutations in BRCA2 have been linked to increased cancer risk. Additionally studies indicate a possible relationship between Rad51L1 dysfunction and Fanconi anemia where its interaction with FA proteins can influence disease progression. Understanding these connections highlights the importance of Rad51L1 in maintaining cellular health and preventing malignancies.

Specifications

Form

Liquid

General info

Function

Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents. May promote the assembly of presynaptic RAD51 nucleoprotein filaments. Binds single-stranded DNA and double-stranded DNA and has DNA-dependent ATPase activity. Part of the RAD51 paralog protein complex BCDX2 which acts in the BRCA1-BRCA2-dependent HR pathway. Upon DNA damage, BCDX2 acts downstream of BRCA2 recruitment and upstream of RAD51 recruitment. BCDX2 binds predominantly to the intersection of the four duplex arms of the Holliday junction and to junction of replication forks. The BCDX2 complex was originally reported to bind single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA. The BCDX2 subcomplex RAD51B : RAD51C exhibits single-stranded DNA-dependent ATPase activity suggesting an involvement in early stages of the HR pathway.

Sequence similarities

Belongs to the RecA family. RAD51 subfamily.

Post-translational modifications

Phosphorylated on tyrosine residues by BCR-ABL.

Subcellular localisation

Nucleus

Product protocols

Target data

Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents. May promote the assembly of presynaptic RAD51 nucleoprotein filaments. Binds single-stranded DNA and double-stranded DNA and has DNA-dependent ATPase activity. Part of the RAD51 paralog protein complex BCDX2 which acts in the BRCA1-BRCA2-dependent HR pathway. Upon DNA damage, BCDX2 acts downstream of BRCA2 recruitment and upstream of RAD51 recruitment. BCDX2 binds predominantly to the intersection of the four duplex arms of the Holliday junction and to junction of replication forks. The BCDX2 complex was originally reported to bind single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA. The BCDX2 subcomplex RAD51B : RAD51C exhibits single-stranded DNA-dependent ATPase activity suggesting an involvement in early stages of the HR pathway.
See full target information RAD51B

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com