JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB157035

Recombinant Human RBX1 protein

5

(1 Review)

|

(0 Publication)

Recombinant Human RBX1 protein is a Human Full Length protein, in the 1 to 108 aa range, expressed in Escherichia coli, with >98%, suitable for SDS-PAGE.

View Alternative Names

RNF75, ROC1, RBX1, E3 ubiquitin-protein ligase RBX1, E3 ubiquitin-protein transferase RBX1, Protein ZYP, RING finger protein 75, RING-box protein 1, Regulator of cullins 1, Rbx1

1 Images
SDS-PAGE - Recombinant Human RBX1 protein (AB157035)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human RBX1 protein (AB157035)

SDS-PAGE image of ab157035 Lane 1 : MW markers (top to bottom) 200, 116, 97, 66, 55, 45, 36, 29, 24, 20, 14.2, 6.5 kDa. Lane 2 : ab157035 (2µg)

Key facts

Purity

>98% SDS-PAGE

Expression system

Escherichia coli

Tags

6x His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P62877

Animal free

No

Carrier free

No

Species

Human

Storage buffer

Constituents: 0.6% Tris, 0.29% Sodium chloride, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH","proteinLength":"Full Length","predictedMolecularWeight":"14 kDa","actualMolecularWeight":null,"aminoAcidEnd":108,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P62877","tags":[{"tag":"6x His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

RBX1 also known as RING-box protein 1 or ROC1 acts as an E3 ubiquitin ligase part of the ubiquitin-proteasome system. This protein facilitates the transfer of ubiquitin from E2 enzymes to target substrates marking them for degradation. The molecular weight of RBX1 is approximately 12 kDa. RBX1 is mainly expressed in various human tissues with significant expression in the heart brain and skeletal muscle. Its expression in these tissues suggests a wide involvement in cellular processes.
Biological function summary

RBX1 associates with the cullin-RING ubiquitin ligase (CRL) complex. It interacts with cullin proteins and other regulatory subunits to promote the polyubiquitination and subsequent degradation of target proteins. This regulatory activity influences many cellular processes including cell cycle progression DNA repair and signal transduction. By ensuring the degradation of proteins at the right time RBX1 maintains cellular homeostasis.

Pathways

RBX1 plays an important role in the control of protein stability through the ubiquitin-proteasome pathway. This pathway is important for regulating key cellular functions like the entrainment of the cell cycle and apoptosis. RBX1 also interacts with proteins like SKP1 and CUL1 as part of the SCF complex which targets specific proteins for degradation. By modulating these pathways RBX1 contributes to the overall regulation of cellular growth and stress responses.

RBX1's malfunctioning links to various types of cancer and neurodegenerative diseases. In cancer altered RBX1 activity can lead to the inappropriate degradation of tumor suppressor proteins promoting uncontrolled cell division. RBX1 is also implicated in neurodegenerative disorders where misregulation of protein degradation contributes to the accumulation of damaged proteins exacerbating disease progression. Additionally the interaction of RBX1 with proteins like p53 in cancer and tau proteins in Alzheimer's illustrates its potential role in disease pathogenesis.

Specifications

Form

Liquid

Additional notes

Purified by nickel sepharose affinity chromatography.

General info

Function

E3 ubiquitin ligase component of multiple cullin-RING-based E3 ubiquitin-protein ligase (CRLs) complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins, including proteins involved in cell cycle progression, signal transduction, transcription and transcription-coupled nucleotide excision repair (PubMed : 10230407, PubMed : 10579999, PubMed : 11961546, PubMed : 15983046, PubMed : 16678110, PubMed : 19112177, PubMed : 19679664, PubMed : 22748924, PubMed : 23455478, PubMed : 27565346, PubMed : 29769719, PubMed : 32355176, PubMed : 33417871, PubMed : 37844242, PubMed : 38326650, PubMed : 39504960, PubMed : 39667934, PubMed : 38316879). CRLs complexes and ARIH1 collaborate in tandem to mediate ubiquitination of target proteins, ARIH1 mediating addition of the first ubiquitin on CRLs targets (PubMed : 27565346). The functional specificity of the E3 ubiquitin-protein ligase complexes depends on the variable substrate recognition components. As a component of the CSA complex mediates ubiquitination of Pol II subunit POLR2A at 'Lys-1268', a critical TC-NER checkpoint (PubMed : 32355176, PubMed : 34526721). Core component of the Cul7-RING(FBXW8) ubiquitin ligase complex, which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed : 35982156). Core component of a Cul9-RING ubiquitin ligase complex composed of CUL9 and RBX1, which mediates mono-ubiquitination of p53/TP53 (PubMed : 38605244). Recruits the E2 ubiquitin-conjugating enzyme CDC34 to the complex and brings it into close proximity to the substrate. Probably also stimulates CDC34 autoubiquitination. May be required for histone H3 and histone H4 ubiquitination in response to ultraviolet and for subsequent DNA repair. Promotes the neddylation of CUL1, CUL2, CUL4 and CUL4 via its interaction with UBE2M. Involved in the ubiquitination of KEAP1, ENC1 and KLHL41. In concert with ATF2 and CUL3, promotes degradation of KAT5 thereby attenuating its ability to acetylate and activate ATM. As part of a multisubunit complex composed of elongin BC complex (ELOB and ELOC), elongin A/ELOA, RBX1 and CUL5; polyubiquitinates monoubiquitinated POLR2A (PubMed : 19920177).

Sequence similarities

Belongs to the RING-box family.

Subcellular localisation

Nucleus

Product protocols

Target data

E3 ubiquitin ligase component of multiple cullin-RING-based E3 ubiquitin-protein ligase (CRLs) complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins, including proteins involved in cell cycle progression, signal transduction, transcription and transcription-coupled nucleotide excision repair (PubMed : 10230407, PubMed : 10579999, PubMed : 11961546, PubMed : 15983046, PubMed : 16678110, PubMed : 19112177, PubMed : 19679664, PubMed : 22748924, PubMed : 23455478, PubMed : 27565346, PubMed : 29769719, PubMed : 32355176, PubMed : 33417871, PubMed : 37844242, PubMed : 38326650, PubMed : 39504960, PubMed : 39667934, PubMed : 38316879). CRLs complexes and ARIH1 collaborate in tandem to mediate ubiquitination of target proteins, ARIH1 mediating addition of the first ubiquitin on CRLs targets (PubMed : 27565346). The functional specificity of the E3 ubiquitin-protein ligase complexes depends on the variable substrate recognition components. As a component of the CSA complex mediates ubiquitination of Pol II subunit POLR2A at 'Lys-1268', a critical TC-NER checkpoint (PubMed : 32355176, PubMed : 34526721). Core component of the Cul7-RING(FBXW8) ubiquitin ligase complex, which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed : 35982156). Core component of a Cul9-RING ubiquitin ligase complex composed of CUL9 and RBX1, which mediates mono-ubiquitination of p53/TP53 (PubMed : 38605244). Recruits the E2 ubiquitin-conjugating enzyme CDC34 to the complex and brings it into close proximity to the substrate. Probably also stimulates CDC34 autoubiquitination. May be required for histone H3 and histone H4 ubiquitination in response to ultraviolet and for subsequent DNA repair. Promotes the neddylation of CUL1, CUL2, CUL4 and CUL4 via its interaction with UBE2M. Involved in the ubiquitination of KEAP1, ENC1 and KLHL41. In concert with ATF2 and CUL3, promotes degradation of KAT5 thereby attenuating its ability to acetylate and activate ATM. As part of a multisubunit complex composed of elongin BC complex (ELOB and ELOC), elongin A/ELOA, RBX1 and CUL5; polyubiquitinates monoubiquitinated POLR2A (PubMed : 19920177).
See full target information RBX1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com